KEGG   Hyphomicrobium nitrativorans: W911_04560Help
Entry
W911_04560        CDS       T02943                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hni  Hyphomicrobium nitrativorans
Pathway
hni00071  Fatty acid degradation
hni00280  Valine, leucine and isoleucine degradation
hni00310  Lysine degradation
hni00362  Benzoate degradation
hni00380  Tryptophan metabolism
hni00620  Pyruvate metabolism
hni00630  Glyoxylate and dicarboxylate metabolism
hni00640  Propanoate metabolism
hni00650  Butanoate metabolism
hni00900  Terpenoid backbone biosynthesis
hni01100  Metabolic pathways
hni01110  Biosynthesis of secondary metabolites
hni01120  Microbial metabolism in diverse environments
hni01130  Biosynthesis of antibiotics
hni01200  Carbon metabolism
hni01212  Fatty acid metabolism
hni02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    W911_04560
   00630 Glyoxylate and dicarboxylate metabolism
    W911_04560
   00640 Propanoate metabolism
    W911_04560
   00650 Butanoate metabolism
    W911_04560
  09103 Lipid metabolism
   00071 Fatty acid degradation
    W911_04560
   00072 Synthesis and degradation of ketone bodies
    W911_04560
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    W911_04560
   00310 Lysine degradation
    W911_04560
   00380 Tryptophan metabolism
    W911_04560
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    W911_04560
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    W911_04560
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    W911_04560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hni04147]
    W911_04560
Enzymes [BR:hni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     W911_04560
Exosome [BR:hni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   W911_04560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHB47834
UniProt: V5SD16
Position
964512..965717
Genome map
AA seq 401 aa AA seqDB search
MNVTKRGSGSEPIFIVSPVRTPIGAYNGTLKDIPATELGAVVVRETLRRAGLDPASVGSV
VMGNVVQAGNRMNPARQAAIGGGLPVTAPAMTVNRVCGSGAQAVVTAAQQIASGEIGVAI
AGGMENMDRAPYLMGNGRWGYRMGPAQMHDSMLTDGLNDAFSGEHSGWHTEDLVTRSQLS
REDQDRFALRSQHRFAAAHAAGHFADEIVAVDVKGRKGTLQFARDEAPRPDTTGEGLAAL
KPAFRKDGTITAGNAPGLNSGAAAMIVASAGAVARHGLAPMARIVSYGIAAVEPGLFGLG
PVPAVRIALDRAGWSIADIERIEVNEAFAAVPLAVAKDLGLPEDVINVEGGAIAHGHPIG
ATGAVLITRLLHSMKRDGLQRGIVTLCIGGGQGIALALERD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtgaccaagcgtggttctggctccgagccgatttttatcgtcagtcccgtcaga
acgcccatcggtgcctacaacggtacccttaaggatatccccgcgaccgagctcggtgcc
gtggtcgtgcgtgaaaccctgcggcgcgcgggactcgatccggcttcggtcgggtctgtc
gtcatgggcaacgtcgtccaggccgggaaccgaatgaacccggctcgccaggcggcaatt
ggcggtggtcttccggtgacggcgccagccatgaccgtcaaccgcgtgtgcggctcagga
gcgcaggcggtcgtcacggccgctcagcagatcgcgtcgggtgagatcggcgtcgcaatc
gccggcggtatggagaacatggacagggcgccgtacctcatgggcaacggccgatggggc
taccgtatgggcccggcccagatgcacgacagcatgctgaccgatggcctgaacgatgcc
ttctctggtgagcattccggctggcatacagaagatctcgttacgcggtcgcagctctcg
cgcgaggatcaggatcggtttgccctcagatctcagcatcggttcgcggccgcccacgcc
gcgggacactttgctgatgagatcgtcgcggtggatgtgaaggggcgcaaggggacactg
cagttcgcgcgcgacgaggcgccccgtcccgatacgactggcgagggcctcgcggccctc
aagcctgcgttccgcaaggatggcactataacggctgggaatgcaccgggtctcaatagc
ggcgcggctgccatgatcgtcgcgagcgcgggtgccgtcgcacggcacggtcttgctcca
atggcccggatcgtgtcctacgggatcgcagcagtcgagcccggtctgttcggtctcggc
cctgtaccggcggttcgtatcgccctagaccgcgccggctggtcgattgccgacatcgag
cgcatcgaggtcaacgaggcgtttgccgcggtgccgctggcggtggccaaggatcttggt
ctgccggaggatgtcatcaacgtcgagggcggcgccatcgctcatggacatccgatcggc
gccacgggtgcggttctgatcacgcgtctgttgcactccatgaagcgcgatggccttcaa
cgcggcattgtcaccctttgcatcggtggcggacagggaatcgctctcgcgctggagcgt
gactaa

DBGET integrated database retrieval system