KEGG   Hyphomicrobium nitrativorans: W911_06610Help
Entry
W911_06610        CDS       T02943                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
hni  Hyphomicrobium nitrativorans
Pathway
hni00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:hni00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    W911_06610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hni01007]
    W911_06610
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hni03016]
    W911_06610
   03029 Mitochondrial biogenesis [BR:hni03029]
    W911_06610
Enzymes [BR:hni01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     W911_06610
Amino acid related enzymes [BR:hni01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   W911_06610
Transfer RNA biogenesis [BR:hni03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    W911_06610
 Prokaryotic Type
   Other AARSs
    W911_06610
Mitochondrial biogenesis [BR:hni03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    W911_06610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: AHB48129
UniProt: V5SDU6
Position
1387042..1388895
Genome map
AA seq 617 aa AA seqDB search
MAAAKTSAAGEGKAGGALHRYRSHTCGALRPADIGATARLSGWVHRVRDHGGVLFIDLRD
HYGLTQVVADPDSAAFKTAEAVRSEWVIRIDGLVRQRPEGTTNAELPTGEIEVYASEIEV
LSEARELPVPVFGEPDYPEDLRLTYRFLDLRRETLHAIIMRRLAITRSIRQRMHEAGFNE
FPTPILTASSPEGARDFLVPSRIHAGRFYALPQAPQQYKQLLMVSGFDRYFQIAPCFRDE
DPRADRLPGEFYQLDVEMSFVEQEDIFQTMEPIMTGVFEEFADGKRVDTDWQRIPYDTAI
AKYGSDKPDLRNPIEMQDVTEHFRGSGFKVFAGMIEKDPKVRVWAIPAKGGGSRAFCDRM
NAWAQKEGQPGLGYIFWREDEGAAGAGPIAKNVGSERAAAIQEQMGLATGDACFFTAGDP
ARFYKFAGLARDEVGRELKLVDEGRFAFAWIVDFPFYEWNEEEKKIDFSHNPFSMPKGGR
AALEAAEAEGRDALLALKANQYDVVCNGYEIASGSVRNHIPETMVKAFEITGLGQAEVED
RFGGLYRAFQYGAPPHGGMAAGLERMVMLLTGTPTVRDVALFPMNQQAADLLMGAPSDVT
PKQLRELSIRVVAPEKK
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcgaagacatcggcagcaggtgaaggcaaggcggggggcgcgctccaccgc
tatcggtcccacacgtgcggggcgcttcggccggccgatatcggcgcgacggcgcgtctt
tcggggtgggtgcaccgcgtgcgcgatcacggcggcgttctgtttatcgacctgcgcgac
cattacgggttgacgcaggtggtggccgaccccgatagcgcggccttcaagacggcggaa
gcggtgcgctcggaatgggtgatccgcatcgacggcctggtccgtcagcgccccgaaggc
acgacgaacgcggagctgccgaccggcgagatcgaggtttacgccagcgagatcgaggtg
ttgtccgaagcgcgcgagcttccggtgccggtgttcggcgagccggactatccggaggac
ctgcgtctcacctatcgctttttggatctccggcgcgagacgctgcacgcgatcatcatg
aggcggctcgcgatcacgcgctcgatccgccagcggatgcacgaggcgggcttcaacgag
tttccgacgccgatcctcaccgcgtcctcgccggaaggcgcgcgcgacttcctggtgccg
agccgcattcacgcgggccgcttctacgcgctgccgcaggcgccgcagcagtacaagcag
cttctcatggtatcgggtttcgaccgctattttcagatcgcgccgtgcttccgcgacgaa
gacccgcgcgccgaccgtctgccgggcgagttctaccagctcgacgtggaaatgagcttc
gtcgagcaggaggacatcttccagacgatggagcccatcatgacgggggtgttcgaggag
tttgccgacggcaagcgcgtcgacacggactggcagcgcattccttacgacactgcgatt
gcgaagtacggcagcgacaagccggatctgcgtaaccccatcgaaatgcaggacgtgacc
gagcatttccgcgggtcgggtttcaaggtctttgcgggcatgatcgagaaggacccgaag
gtccgcgtgtgggcgatcccggccaagggcggcggcagccgcgcgttctgcgaccgcatg
aatgcgtgggcgcagaaggaaggccaacccggtctcggctacatcttctggcgtgaggat
gagggtgctgctggcgcgggtcccattgcgaagaacgtcggctcggagcgggcggccgcc
atccaggagcagatggggctagcgacgggcgatgcctgcttcttcacggcgggcgatccg
gcgcgcttctacaagttcgcaggtctcgcgcgcgacgaagtcggacgcgagttgaagctc
gtcgacgaagggcgttttgcgttcgcgtggatcgtcgatttcccgttctacgagtggaac
gaggaagagaagaagatcgacttctcgcacaacccgttctcgatgccgaagggcggtcgg
gctgcgcttgaggccgcggaagcggaagggcgcgacgccctgctggcgctcaaagcgaac
cagtacgacgtcgtgtgcaacggctacgagatcgcgtccggctcggtgcgtaaccacatt
ccggagacaatggtgaaggcgttcgagatcacgggtctcgggcaggccgaggtggaggat
cggttcggcggtctctatcgcgcgttccagtatggtgcgcctccgcacggcggcatggcg
gcgggtctcgaacgcatggtgatgctgctgaccggcacgcccacggtgcgcgacgtggcg
ctgttcccgatgaaccagcaggcggccgaccttctgatgggcgcgccctcggacgtgacg
ccgaagcagcttcgggaactctcgatccgcgtcgtcgctccggagaagaaatag

DBGET integrated database retrieval system