KEGG   Hymenobacter nivis: DDQ68_00455Help
Entry
DDQ68_00455       CDS       T05498                                 

Definition
(GenBank) HAD family phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
hnv  Hymenobacter nivis
Pathway
hnv00010  Glycolysis / Gluconeogenesis
hnv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hnv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DDQ68_00455
Enzymes [BR:hnv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     DDQ68_00455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Unstab_antitox
Motif
Other DBs
NCBI-ProteinID: AWM31390
UniProt: A0A2Z3GRW3
Position
complement(86474..87130)
Genome map
AA seq 218 aa AA seqDB search
MLPHLLFDFGGVLIDIDYDRTPAAFRRLSRAGSTVEYSQATQAELFDQLETGQLTPAAFR
DGLRAAYDLEATDEEIDQAWHALLLDVPAERLALVAELRRQGHQTALLSNTNALHIAEIN
RRLAAQYGFKNGIADCLDHVFYSQEVGMRKPGEAFFQHALREMNWRAEDVLFIEDSPQHV
ATARRLGLRVLHLAPPLTLTTALPEALRAFPREYAPLA
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcttccccatttacttttcgacttcggcggcgttctcatcgacattgattacgaccgc
acccccgccgccttccgccgcctgagccgggcgggcagcaccgtggaatacagccaggcc
acgcaggccgaactgttcgaccagctcgaaaccggccagcttaccccggccgcgttccgc
gacgggctgcgcgcggcctacgacctggaggccaccgacgaggaaattgaccaggcgtgg
cacgcactgctgctcgacgtgcccgccgagcgcctggccctagtggccgagctgcgccgc
cagggccaccaaacggcgctgctctccaacaccaacgcgctgcacattgccgaaattaac
cggcggctggcggcgcagtacggcttcaaaaacggcattgccgactgcctcgaccacgtg
ttttactcgcaggaagtggggatgcgcaagccgggcgaggcatttttccagcacgcgctg
cgcgaaatgaactggcgggccgaagacgtgttattcatcgaagacagcccccagcacgtg
gccaccgctcgccgcctggggctgcgggtgctgcacctggccccgccgctcaccctcacc
accgccctgcccgaagccctccgtgcctttccccgagaatacgccccccttgcctga

DBGET integrated database retrieval system