KEGG   Hymenobacter nivis: DDQ68_03275Help
Entry
DDQ68_03275       CDS       T05498                                 

Definition
(GenBank) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
hnv  Hymenobacter nivis
Pathway
hnv00730  Thiamine metabolism
hnv00790  Folate biosynthesis
hnv01100  Metabolic pathways
hnv02020  Two-component system
Module
hnv_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:hnv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DDQ68_03275
   00790 Folate biosynthesis
    DDQ68_03275
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DDQ68_03275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hnv04147]
    DDQ68_03275
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hnv00537]
    DDQ68_03275
Enzymes [BR:hnv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DDQ68_03275
Exosome [BR:hnv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DDQ68_03275
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hnv00537]
 Enzymes
  DDQ68_03275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: AWM31894
UniProt: A0A2Z3GR65
Position
782033..782920
Genome map
AA seq 295 aa AA seqDB search
MQYEAIFNASPTAAYRYTAARDWVLPAPKVGVELDVLFGGGARHFMPRTRGAASSYEAVV
DRTGAPIANTAGAPVTLRGNRADDVDLVKYAVEQRNYQYVNSRDALLNIDLAQYGPGGKK
LLGLFNASHVNYEQDRQTSAAWEPSLADMTATAIKVLQAKSNGKGFFLMVEAGRIDYLEH
FNTGGIAVVAGPGTTNQYAVEADQPVYAGGGDAGGMATPTSARATGVYGSDYMIKEVLAF
DYAVAEGRALLATPTSGKTLIFSTSDHECGGFAVTGLHDEADANRNGTKIRTYAG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacgaggctattttcaacgccagccccacggccgcctaccgctacaccgccgcc
cgcgactgggtgctgccagcccccaaagtaggcgtggagctcgacgtgctgttcggcggc
ggggcccgccacttcatgccccgcacccgcggcgcggctagctcctacgaagcggtggtg
gaccgcaccggggcccccattgcgaacacggccggcgcgcccgtgaccctgcgtggcaac
cgcgccgacgacgtggacctggtgaagtacgccgtggagcagcgcaactaccagtacgtg
aatagccgcgacgccctgctgaacattgacctggcgcagtacggccccggcggcaaaaaa
ctgctgggcctcttcaacgcctcgcacgtcaactacgagcaggaccgccagacgagcgcc
gcctgggagccctcgctggccgatatgacggccacggccatcaaggtgttgcaggccaaa
agcaacggcaaggggttcttcctgatggtggaagctggccgaattgactacctggagcac
ttcaacaccggcggcattgcggtggtggcgggcccgggcaccaccaatcagtacgcggtc
gaggccgaccagccggtgtacgcgggcggcggcgacgccggcggaatggccacgcccacc
tcggcgcgcgccaccggcgtgtacggctccgattacatgatcaaggaagtactggccttt
gactacgccgtggccgagggccgggctctgctagctacgcccaccagcggtaagaccctg
atttttagtacatccgaccacgagtgcggcggctttgctgtaacgggcctgcacgatgag
gccgacgctaatcgcaacggcaccaaaattcgtacctacgccggctag

DBGET integrated database retrieval system