KEGG   Hymenobacter nivis: DDQ68_07290Help
Entry
DDQ68_07290       CDS       T05498                                 

Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
hnv  Hymenobacter nivis
Pathway
hnv00360  Phenylalanine metabolism
hnv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hnv00790  Folate biosynthesis
hnv01100  Metabolic pathways
hnv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hnv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    DDQ68_07290
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DDQ68_07290
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DDQ68_07290
Enzymes [BR:hnv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     DDQ68_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AWM32602
UniProt: A0A2Z3GKM9
Position
1663664..1664401
Genome map
AA seq 245 aa AA seqDB search
MLTQFRAPCYSPQDQLVWKVLFDRQTALLHRRAVPAFGAAVVQLGLRREAIPDLLTLSAE
VSRLSGWQLVPVGQALGTEAFFKLLAKRQFPVMTRIRPMRDFDFSPEPDLFHDLFGHVPM
LLDAHFADFLHTLGLAARALCPDDAVARRELWALYFFTAEFGLVLHEGKPHLYGAGLLSS
AGEIHHCVNEATPRPAFDVETVRRTSVLGTRFQDQYFVLPAWEELADCAAELAGVLVPVP
HRVAA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgcaattccgcgccccctgctattctccccaggaccagttggtttggaaggta
ttgtttgaccgccagacggccctgctgcaccggcgcgccgtgcccgccttcggggccgcc
gtggtccagctcgggttgcgccgcgaggccatccccgatctgctcacgctgagcgccgag
gtatcccggctcagcggctggcagctggtgccggtggggcaggcgctggggaccgaagcg
ttctttaagttgctggccaagcggcagttcccggtgatgacgcgcatccggccgatgcgc
gacttcgacttcagccccgagcccgatctgttccacgaccttttcgggcacgtgcccatg
ctgctcgacgcgcatttcgccgatttcctgcacacgctgggcctcgccgcccgggccctg
tgccccgacgacgcggtggcccgccgcgaactgtgggccctatacttctttacggccgag
tttgggctggtgctgcacgagggcaagccgcatctgtatggcgccggactactatcgtcg
gccggcgaaatccaccattgcgtgaacgaagccacgccgcgccccgcctttgatgtggag
acggtgcggcgcacgtcggtactgggcacccgcttccaagaccaatactttgtgctgccc
gcctgggaagaactggccgactgcgccgccgaactggctggcgtgctggtgcccgtaccg
caccgcgttgctgcctga

DBGET integrated database retrieval system