KEGG   Hymenobacter nivis: DDQ68_10355Help
Entry
DDQ68_10355       CDS       T05498                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
hnv  Hymenobacter nivis
Brite
KEGG Orthology (KO) [BR:hnv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DDQ68_10355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AWM33144
UniProt: A0A2Z3GUP3
Position
2330494..2330880
Genome map
AA seq 128 aa AA seqDB search
MPTTTTQGVTVSVTTNYLPDYSSPTQEHFVFAYKITIRNNSEFTVKLLRRHWHIHDANSP
VREVEGEGVVGRQPVLEPGQSHHYMSGCNLKSGVGKMRGTYLMERVANGQEFSVEIPEFT
LIVPFRLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccaccactacgcagggcgttaccgtttcggttacgacaaattacctgcctgat
tattccagccccacgcaggagcatttcgtgttcgcctataaaattacgattcgcaacaac
agcgagttcaccgtgaagctgttgcggcgccactggcacattcacgacgccaacagcccc
gtgcgcgaggtggagggcgaaggcgtggtaggccgccagcccgtgcttgaacccggccag
tcgcaccactatatgagcggctgcaacctgaagtcgggcgtgggcaaaatgcgcggcacc
tacctgatggagcgcgtagccaacggccaggaattcagcgttgaaattcccgagttcacc
ctcatagtgcccttccgcctgaactga

DBGET integrated database retrieval system