KEGG   Hoeflea sp. IMCC20628: IMCC20628_01043Help
Entry
IMCC20628_01043   CDS       T03926                                 

Definition
(GenBank) adenosylcobyric acid synthase (glutamine-hydrolysing)
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
hoe  Hoeflea sp. IMCC20628
Pathway
hoe00860  Porphyrin and chlorophyll metabolism
hoe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    IMCC20628_01043
Enzymes [BR:hoe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     IMCC20628_01043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26
Motif
Other DBs
NCBI-ProteinID: AKH99760
UniProt: A0A0F7PHX5
Position
1104229..1105680
Genome map
AA seq 483 aa AA seqDB search
MFQGTGSDVGKTVLVAGFCRLAANHGLKVRPFKPQNMSNNAAVADDGGEIGRAQWLQALA
CRVPASVHMNPVLLKPQSETGSQVVVQGKVVGHARGRDYQKLKPQLMAAVLDSFARVADG
ADLVLVEGAGSPAEINLRPGDIANMGFATAAGVPVVLVGDIDRGGVIASVVGTHTILTDE
DRAMIAGYLINKFRGDVSLFDDGISAIDRFTGWPCLGVIPWLKSAARLPAEDSVALERLT
RGEARALKIAVPVLSRIANFDDFDPLRAEPEVELVFVRPGEQLPDDAGLVILPGSKSTIA
DLADLRRQGWDKDLQAHHRRGGRIIGICGGYQMLGRSVCDPQAVEGGETMAEGLGFLDIE
TEMAPEKTVRNIHAHSAVHDVALSGYEIHLGVSQGPDCARPMTILDGRPEGAMSFDGKVS
GTYLHGLFDSDAYRAKLLAEFGIRGGETNYRADVDAALDEIAAELDRLVGFERIMSASAL
IGR
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagggaacaggttcggatgtcggcaagaccgtgctggttgcgggtttttgccgg
ctggcggcaaaccatggcctaaaggttcgaccgttcaagccgcaaaacatgtccaacaac
gccgcggtcgccgatgacggcggcgaaatcggccgggcgcaatggctgcaggcgctggct
tgccgggtgcctgcgagcgtgcacatgaacccggtgctgctcaaaccgcagtcggaaacc
ggatcccaggtggtggttcaagggaaagttgttggccatgcgcgtggccgcgactaccag
aaactcaagcctcagctgatggcggcggtgctggacagctttgcccgcgtcgcagacggc
gccgatctggtgctggtcgagggcgcgggctcgccagcggaaatcaatctccggcccggc
gacatcgccaatatgggctttgcgacagcggcgggtgtgccggtggtgctggtcggcgac
atcgaccgtggcggcgttatcgcctcggtggtcggcacccacacgatcctgacagacgaa
gaccgggcgatgattgccggctatctgatcaacaagttccgcggcgatgtcagcctgttt
gatgacggcatctcggcgattgaccgctttaccggctggccctgtctcggagtgattcca
tggctcaaatccgcagcacgtctgccggcggaagattccgtggcgctggaacggctgacg
cggggtgaggcgcgggcgctgaagatcgcggtcccggtgttgtcgcggatcgccaatttt
gatgatttcgatccgctcagggccgagccggaggtggaactggtgttcgtgcgtccggga
gaacagcttcccgatgacgccggtctggtgatcctgcccggatcgaaatccaccatcgcc
gatcttgccgatctccgtcgtcagggctgggacaaggatctgcaggcgcatcaccggcgt
ggcgggcggatcatcgggatatgcggcggttaccagatgctggggcgcagtgtgtgcgac
ccgcaggcggtggagggcggcgagaccatggccgagggtctgggatttctcgatatcgag
accgagatggcaccggagaaaacggtgcgcaacattcacgcacactcggcggtacacgat
gtcgccttgtcgggctacgagatccatctcggtgtcagccaaggaccggactgtgcgcgg
ccgatgaccattcttgacggccgtcccgagggtgcaatgtctttcgatggcaaggtgtcg
ggaacctatctgcatggcctgttcgattcggatgcctatcgcgcaaagctgcttgcagaa
tttggaatccgcggcggggagaccaattaccgggctgatgtcgatgcggcacttgatgaa
attgctgctgaacttgaccgtctcgtcggatttgagcgcatcatgagcgcttccgcactg
attggtcgctga

DBGET integrated database retrieval system