KEGG   Hoeflea sp. IMCC20628: IMCC20628_01534Help
Entry
IMCC20628_01534   CDS       T03926                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hoe  Hoeflea sp. IMCC20628
Pathway
hoe00010  Glycolysis / Gluconeogenesis
hoe00053  Ascorbate and aldarate metabolism
hoe00071  Fatty acid degradation
hoe00280  Valine, leucine and isoleucine degradation
hoe00310  Lysine degradation
hoe00330  Arginine and proline metabolism
hoe00340  Histidine metabolism
hoe00380  Tryptophan metabolism
hoe00410  beta-Alanine metabolism
hoe00561  Glycerolipid metabolism
hoe00620  Pyruvate metabolism
hoe00625  Chloroalkane and chloroalkene degradation
hoe00903  Limonene and pinene degradation
hoe01100  Metabolic pathways
hoe01110  Biosynthesis of secondary metabolites
hoe01120  Microbial metabolism in diverse environments
hoe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IMCC20628_01534
   00053 Ascorbate and aldarate metabolism
    IMCC20628_01534
   00620 Pyruvate metabolism
    IMCC20628_01534
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IMCC20628_01534
   00561 Glycerolipid metabolism
    IMCC20628_01534
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IMCC20628_01534
   00310 Lysine degradation
    IMCC20628_01534
   00330 Arginine and proline metabolism
    IMCC20628_01534
   00340 Histidine metabolism
    IMCC20628_01534
   00380 Tryptophan metabolism
    IMCC20628_01534
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    IMCC20628_01534
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    IMCC20628_01534
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    IMCC20628_01534
Enzymes [BR:hoe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     IMCC20628_01534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AKI00250
UniProt: A0A0F7PL20
Position
complement(1606389..1607759)
Genome map
AA seq 456 aa AA seqDB search
MTQIADMIADLRETFARHKTRPLEWRRGQLQRLSAMIKDNEADILADLKADLGRSGYESR
LVETNTVQSEISHVLKHLKSWMRPQRVPTPLTNQPGRSEIVPEPLGVVLIMAPWNYPVYL
ICMPLIGAIAAGNCAVLKPSEISANTSKLLARLIPAYMDSEAIRIVEGDADTASELLAER
FDHIFFTGSQAIGKIVMTEAAKHLTPVTLELGGKSPCIVEPDCDLETAARRIAWGKFLNA
GQTCVAPDYLLVHETVAGDFVTHLKSSLTRFYGENPKTSPDYPRIINDKHFARVSRLIAD
GQIECGGETDPASRYIAPTILTGVDPASAVMSQEIFGPVLPVITYATIDEAIGFITARPK
PLALYLFSNSTDIRDRVMTETSSGGAVINDVVTHLAVPELPFGGVGASGMGACHGRASFD
TFSHAKAVLTKSEKFEVKLRYPPFSALKSRLIKLVS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacccagattgccgacatgattgcagatctccgcgagacatttgcacgccacaagacc
cggccgctcgaatggcggcgggggcagttgcagcgcctcagcgccatgatcaaggacaat
gaggcagacatcctcgcagacctgaaggctgacctgggccgctcgggctacgagtcgcgg
ctggtcgagaccaataccgttcaatccgagatcagccacgtgctcaagcatctcaagtca
tggatgcggccgcagcgggtgccaacgccgctgaccaaccagcccggccgctcggaaatc
gtgcccgaaccgctgggcgtggtgctgatcatggcgccgtggaattatccggtctacctg
atctgcatgccgttgatcggagcgatcgcggcaggcaattgcgcggtgctgaagccgtcg
gagatttccgccaacacgtccaagctgctggcacggctgattccggcctatatggattcc
gaggcaatccggattgtcgaaggtgatgccgacaccgccagcgagctgctggccgagcgg
ttcgaccatattttcttcaccggcagccaggccattggcaagatcgtcatgaccgaagcg
gcgaaacatctgaccccggtgacgctggaactgggcggcaagagcccctgcatcgtcgag
cctgattgcgatctcgagaccgcggcgcggcgtattgcctgggggaaatttctcaatgcc
ggccagacctgcgtggcgcccgattacctgctggtgcacgaaaccgttgccggtgacttc
gtcacccatctgaagagctcgctgacgcggttttatggcgaaaatccgaagaccagcccc
gattatccgcgcatcatcaacgacaagcattttgcccgcgtcagccggttgatcgccgat
ggccagattgaatgcggcggcgagaccgatccggcctcgcgctatatcgcgccgaccatt
ctcaccggcgtggatccggcgtcagcggtgatgagccaggagattttcgggccggtgctg
cctgtgatcacctatgcaacaatcgacgaggcaatcggcttcatcaccgccagacccaag
ccgctggcgctgtatctgttctccaattcgaccgacattcgcgaccgggtgatgaccgag
accagctcgggcggtgccgtgatcaacgacgtggtcacccatctcgccgtgccggaactg
ccgtttggcggcgttggcgccagcggcatgggcgcctgtcacggccgcgcctcgtttgac
acattcagccatgccaaggctgtgctgacaaaatcggaaaagttcgaagtcaaactgcgc
tacccgccattctcggcgctcaaatcccggctgatcaagctggtcagttga

DBGET integrated database retrieval system