KEGG   Hoeflea sp. IMCC20628: IMCC20628_03631Help
Entry
IMCC20628_03631   CDS       T03926                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hoe  Hoeflea sp. IMCC20628
Pathway
hoe00071  Fatty acid degradation
hoe00072  Synthesis and degradation of ketone bodies
hoe00280  Valine, leucine and isoleucine degradation
hoe00310  Lysine degradation
hoe00362  Benzoate degradation
hoe00380  Tryptophan metabolism
hoe00620  Pyruvate metabolism
hoe00630  Glyoxylate and dicarboxylate metabolism
hoe00640  Propanoate metabolism
hoe00650  Butanoate metabolism
hoe00900  Terpenoid backbone biosynthesis
hoe01100  Metabolic pathways
hoe01110  Biosynthesis of secondary metabolites
hoe01120  Microbial metabolism in diverse environments
hoe01130  Biosynthesis of antibiotics
hoe01200  Carbon metabolism
hoe01212  Fatty acid metabolism
hoe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IMCC20628_03631
   00630 Glyoxylate and dicarboxylate metabolism
    IMCC20628_03631
   00640 Propanoate metabolism
    IMCC20628_03631
   00650 Butanoate metabolism
    IMCC20628_03631
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IMCC20628_03631
   00072 Synthesis and degradation of ketone bodies
    IMCC20628_03631
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IMCC20628_03631
   00310 Lysine degradation
    IMCC20628_03631
   00380 Tryptophan metabolism
    IMCC20628_03631
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IMCC20628_03631
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IMCC20628_03631
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IMCC20628_03631
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hoe04147]
    IMCC20628_03631
Enzymes [BR:hoe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IMCC20628_03631
Exosome [BR:hoe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IMCC20628_03631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AKI02317
UniProt: A0A0F7PLZ3
Position
3810288..3811496
Genome map
AA seq 402 aa AA seqDB search
MVDVFVYDHVRTPRGRGKKDGSLHEVPSVRLASHMLEALRDRNGLDTSTVDDIIMGCVDA
IGEAGGDIARAATFEAGYATEAPGIQINRFCASGLDAINLASGKIAYGADDIVIAGGVES
MSRIGIGAQGGAWFMDPSVNIPAYFMPQGISADLIATKYGFSRDDVDAYAVESQKRAAHA
WEKGYFKKSVVPVKDINGLNILDHDEHMRPGTDMQTLASLNASFGMMAQMGGFDAVAIQA
HPEIETINHIHHAGNSSGIVDGASLVLLGSKKGGKSMGLEPRAKIRAFANIGSDPAMMLT
GPVDVTEKLLKRAKMKIEDIDLFELNEAFASVVLRFQQAFDIPSDKINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggttgatgtatttgtctatgatcacgtccgcaccccgcggggccgcggcaagaaagac
ggaagcctgcatgaggttccttccgtgcggctggcctctcacatgctcgaggccctgcgc
gaccgcaacgggctcgacaccagcactgtcgacgacatcatcatgggctgcgtcgacgcc
ataggcgaagccggcggcgatattgcccgcgcggcgacttttgaagccggatacgccaca
gaggcgcccgggatccagatcaaccgcttctgtgcctccggcctcgacgcgatcaatctc
gcctccggcaagattgcctatggcgcagacgatatcgtcattgccggtggcgtggaatcg
atgtcgcgcatcggcatcggcgcccagggcggtgcctggttcatggatccttcggtcaac
atcccggcctatttcatgccgcagggcatttcagccgacctgatcgccaccaaatacggc
ttctcccgcgacgatgtcgacgcctatgcggtggagagccagaagcgtgcggcgcatgcc
tgggagaagggctacttcaaaaaatcggtggtcccggtcaaggacatcaacggcctgaat
atcctcgaccatgacgagcatatgcggcccggcaccgacatgcagacgcttgccagcctc
aacgcttcattcggcatgatggcccagatgggcggctttgacgccgtcgccatccaggcg
catccggaaatcgaaaccatcaaccacatccatcatgcaggcaactcgtcgggcatcgtt
gatggcgccagcctggtgctgcttggctcgaagaagggcggcaagtcgatgggcctcgag
ccgcgcgccaagatccgcgccttcgccaatatcggttccgacccggcgatgatgctgacc
ggtccggttgatgtgaccgagaagcttctcaagcgcgccaagatgaagatcgaagacatt
gatctgttcgagctcaacgaggctttcgcatccgttgtgctgcgcttccagcaggccttc
gacattccgtccgacaagatcaacgtcaatggcggcgcgattgccatggggcacccgctg
ggcgccaccggcgcgatgatcctcggcactgtgcttgatgaactcgagcgccgtgatctc
aacaccgcccttgtcactctgtgcatcggcgcgggcatgggcaccgcgacgatcatcgaa
cgcgtctga

DBGET integrated database retrieval system