KEGG   Hoeflea sp. IMCC20628: IMCC20628_03645Help
Entry
IMCC20628_03645   CDS       T03926                                 

Definition
(GenBank) uncharacterized protein affecting Mg2+/Co2+ transport
  KO
K06195  ApaG protein
Organism
hoe  Hoeflea sp. IMCC20628
Brite
KEGG Orthology (KO) [BR:hoe00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    IMCC20628_03645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AKI02329
UniProt: A0A0F7PSW9
Position
3824868..3825260
Genome map
AA seq 130 aa AA seqDB search
MYRALTREIEVTVEPYYLEDQSDPEDGRYVWGYRIVIANLSDQIVQLRSRHWRITDEYGI
VDEVRGPGVVGEQPILGPGDTYEYSSGCPLDAPSGVMVGSYQMQSAEGELFDVEIPAFSL
DLPGMARTLN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgcactaacccgtgagatagaagtcaccgttgagccgtattatctcgaggac
cagtcggaccccgaggacgggcgctatgtgtggggttaccgcatcgtgatcgccaacctt
tccgaccagattgtccagcttcgaagcaggcattggcggatcaccgacgagtacgggatt
gtcgatgaggttcgtggccctggcgtcgttggcgaacagccgatactcggccctggcgac
acttatgagtattcctccggctgcccgctggatgcgccctcaggtgtcatggtcggctcc
taccagatgcaatcagccgaaggcgaactttttgatgtcgagatcccggcattctctctg
gatctgcccggcatggcaagaacgctgaattga

DBGET integrated database retrieval system