KEGG   Haliangium ochraceum: Hoch_1657Help
Entry
Hoch_1657         CDS       T01103                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00071  Fatty acid degradation
hoh00072  Synthesis and degradation of ketone bodies
hoh00280  Valine, leucine and isoleucine degradation
hoh00310  Lysine degradation
hoh00362  Benzoate degradation
hoh00380  Tryptophan metabolism
hoh00620  Pyruvate metabolism
hoh00630  Glyoxylate and dicarboxylate metabolism
hoh00640  Propanoate metabolism
hoh00650  Butanoate metabolism
hoh00900  Terpenoid backbone biosynthesis
hoh01100  Metabolic pathways
hoh01110  Biosynthesis of secondary metabolites
hoh01120  Microbial metabolism in diverse environments
hoh01130  Biosynthesis of antibiotics
hoh01200  Carbon metabolism
hoh01212  Fatty acid metabolism
hoh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hoch_1657
   00630 Glyoxylate and dicarboxylate metabolism
    Hoch_1657
   00640 Propanoate metabolism
    Hoch_1657
   00650 Butanoate metabolism
    Hoch_1657
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Hoch_1657
   00072 Synthesis and degradation of ketone bodies
    Hoch_1657
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Hoch_1657
   00310 Lysine degradation
    Hoch_1657
   00380 Tryptophan metabolism
    Hoch_1657
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Hoch_1657
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Hoch_1657
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Hoch_1657
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hoh04147]
    Hoch_1657
Enzymes [BR:hoh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Hoch_1657
Exosome [BR:hoh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Hoch_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACY14207
UniProt: D0LWW0
Position
2256646..2257851
Genome map
AA seq 401 aa AA seqDB search
MEAYIYDHVRTPRGRGRAEGSLHEITPIQLAAQTLSALRERNELDTALVDDVILGCVSPV
GEQGANLGRVAALRAGFAETVAGQQINRFCASALEAVNLGAAVVHAGAAQAVIAGGVESM
SRVRMGSDGGPWYSDPQTTWACGYSPQGIGADLLATLDGYSRDDLDVFALASQQRAARAW
KQKYFRASIVPVCDLMGEIVLDHDEHMRPDTRPEDLARLRPAFAAMGESQGFDAVALQRY
PEVERIEHLHTGGNSSGIVDGAAAVLIGDRDFGRATGMRPRARIRGFRSIGSEPTLMLSG
PGPCSRQLLERLGMHTHNIDLFEVNEAFAAVALRFMRDMEIEHDKTNVNGGAIAMGHPLG
ATGAMLLGIALDELERRQLSTALVTLCAAAGMATATVIERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctacatctacgatcacgtccgcacgccgcggggcaggggtcgcgccgagggc
agcttgcacgagatcacgccgatccagctcgcggcccagacgctctcggctctgcgcgag
cgcaacgaactcgacaccgccctggtcgacgacgtgatcctcggctgcgtgtcgccggtg
ggtgagcaaggcgccaatctcggacgcgtggccgcactccgcgcgggcttcgccgagacg
gtcgccgggcaacagatcaatcgcttctgcgcctctgcgctcgaggccgtcaatctcggc
gccgccgtggtccacgcgggcgcggcccaggccgtgatcgcgggcggcgtggagtcgatg
tcgcgggtgcgcatgggctcggacggcggcccctggtattccgacccgcagaccacgtgg
gcgtgtggctactcgccgcagggcatcggcgccgatctgctggcaacgctcgacggctac
agccgcgacgatctcgacgtgttcgccctggcctcgcagcagcgcgcggcccgggcctgg
aagcagaagtacttccgcgcctcgatcgtgccggtgtgcgatctcatgggcgagatcgtt
ctcgaccacgacgagcacatgcgcccggacacccgtcccgaagacctggcgcggctgcgg
ccggcgttcgcggctatgggcgagagccagggcttcgacgccgtggccctgcagcgctac
cccgaggtcgagcgcatcgagcacctacacaccggcggcaactcctcgggcatcgtcgat
ggcgccgcggccgtgctcatcggcgatcgcgatttcggacgcgccaccggaatgcgtccg
cgggcgcgcatccgcggctttcgctcgatcggttcggagccgaccctgatgctcagcggg
ccggggccgtgcagccgacagctcctcgagcgtctgggcatgcacacccacaacatcgat
ctcttcgaggtcaacgaggcctttgccgcggtcgccctgcgcttcatgcgcgacatggag
atcgagcacgacaagaccaacgtcaacggcggcgccatcgcgatggggcatccgctgggc
gcgaccggggccatgctcctgggtatcgcgctcgacgagctggagcgccgccagctcagc
acggctctggtcacgctgtgcgcggccgccggcatggccactgccacggtcatcgagcgg
gtgtga

DBGET integrated database retrieval system