KEGG   Haliangium ochraceum: Hoch_1838Help
Entry
Hoch_1838         CDS       T01103                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00450  Selenocompound metabolism
hoh00970  Aminoacyl-tRNA biosynthesis
hoh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hoh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Hoch_1838
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Hoch_1838
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hoh01007]
    Hoch_1838
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hoh03016]
    Hoch_1838
Enzymes [BR:hoh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Hoch_1838
Amino acid related enzymes [BR:hoh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Hoch_1838
Transfer RNA biogenesis [BR:hoh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Hoch_1838
 Prokaryotic type
   Other AARSs
    Hoch_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACY14386
UniProt: D0LY31
Position
2529126..2530799
Genome map
AA seq 557 aa AA seqDB search
MKTLITAGLPYINGIKHLGNLVGSMLPADVYARFLRQEGDEVLYVCATDEHGVPAELAAH
EAGQPVEAFCEAQHQIQADIYRRFGIAFDYFGRSSAPSNHELTREIFSQLADNGFIEKRA
TQQVYSLDDQRYLPDRYVIGTCPRCGYEAARGDQCESCTTLLDPTDLIEPRSAVSGSTKL
EVRSTEHLYLLLSKLEPTVKDWVEEQGQWPPLTRQVAGKWLGEGLRDRCITRNLAWGVDV
PGEEELVFYVWFDAPIGYIAATRDWAESSGQPDAWKAYWQDATDVHYVQFMGKDNLPFHT
IMFPAMLMGASSSWNLPDQIKGLHWLNYYGGKFSTSQKRGVFSDAALELFPADYWRYALM
AQIPETSDSTFTWEMFASAVNKDLASVLGNFVNRVLRFTRSKFGETLPEGGSPGPAEAAL
QEECEAQVKLFRASMRALEFRRAMQALRKLWTIGNTYIDTEAPWAAIKTDRDRAAVVIRT
CFNLLRLYGVSAQPIMPTLSASVLDALQLSDAERSGHAGEHVDLSLLGPGRPFEAIPPLV
TQIDDDRLEELKQRFGC
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctgatcacggctggtctcccctacatcaacgggatcaaacacctcggcaac
ctggtcggctcgatgctgccggccgatgtgtacgcgcgcttcctgcgccaggagggcgac
gaggtcctctacgtctgcgccaccgatgagcacggcgtcccggccgagctggccgcgcac
gaggccgggcagccggtcgaggccttctgcgaagcccagcaccagatccaggccgacatc
taccgccgcttcggcatcgccttcgactacttcggccgcagctcggcgccctcgaaccac
gagctgacccgcgagatcttctcccagctcgccgacaacggcttcatcgagaagcgcgcc
acgcagcaggtgtactcgctcgacgaccagcgctatctgcccgaccgctacgtcatcggc
acctgcccgcgctgcggctacgaggccgcccgcggcgaccagtgcgagagctgcaccacg
ctgctcgatcccaccgacctgatcgagccgcgctcggcggtgtcgggttcgaccaagctc
gaggtgcgctccaccgagcacctctatctattgctctccaagctcgagcccacggtcaag
gactgggtcgaggagcagggccagtggccgccgctcacccgccaggtcgcgggcaagtgg
ctgggcgagggcctacgcgaccgctgcatcacgcgcaacctggcctggggcgtagacgtc
cccggcgaagaggagctggtgttctacgtctggttcgacgcgcccatcggctacatcgcg
gccacccgcgactgggccgagagcagcggccagcccgatgcctggaaggcctactggcag
gacgccaccgacgtccactacgtgcagttcatgggcaaggataacctgcccttccatacg
atcatgttcccggccatgctcatgggcgccagcagctcgtggaacctgcccgaccagatc
aagggcctccactggctcaactactacggcggcaagttctcgacctcgcagaagcgcggc
gtgttctccgacgctgcgctcgagctgttcccggccgactactggcgctacgcgctcatg
gcccagatccccgagaccagcgacagcaccttcacctgggagatgttcgcgtcggccgtg
aacaaggatctggcctcggtgctcggcaacttcgtcaaccgcgtgctgcgcttcacccgc
tccaagttcggcgagaccctgcccgagggcggcagcccgggcccggccgaggccgcgctg
caagaggagtgcgaggcccaggtcaagctgttccgcgcgtcgatgcgcgcgctcgagttc
cgccgcgccatgcaggcgctgcgcaagctgtggaccatcggcaacacctacatcgacacc
gaggcgccgtgggcggcgatcaagaccgaccgcgatcgcgcggccgtggtcatccgcacc
tgcttcaacctgctgcgcctgtacggcgtgagcgcgcagccgatcatgccgacgctgtcc
gcgtccgtgctcgacgccctgcagctcagcgacgccgagcgcagcggccacgccggcgaa
cacgtcgacctcagcttgctcggtcccggacgtccgttcgaggccatcccgcccctggtc
acccagatcgatgacgaccgcctcgaggagctgaagcaacgcttcggctgttga

DBGET integrated database retrieval system