KEGG   Haliangium ochraceum: Hoch_2310Help
Entry
Hoch_2310         CDS       T01103                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K00302  sarcosine oxidase, subunit alpha [EC:1.5.3.1]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00260  Glycine, serine and threonine metabolism
hoh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hoch_2310
Enzymes [BR:hoh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase
     Hoch_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_4 Pyr_redox_2 FAD_oxidored NAD_binding_8 HI0933_like FAD_binding_2 GIDA FAD_binding_3 Thi4 DAO Fer2_3 Pyr_redox_3 Pyr_redox AlaDh_PNT_C Lycopene_cycl Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: ACY14853
UniProt: D0LI24
Position
complement(3211639..3212997)
Genome map
AA seq 452 aa AA seqDB search
MNARLPILDTAPAWARRETPVQLRLDGDPVRGYANESVAVGLYASGHRVLSRSIKYHRPR
AFFCLEGHCGGCLMRIDGVPNQRACQQPCREGLRLEPQNAYPSADLDVLEAVDWLFPGGM
NHHTLMTGSPLLNAVANKIVRKLSGLGEAPTAPPARLPRAEELAPEVLVVGGGPAGLTAA
TAAARGGARTLLIEEQPVLGGSLLADPRFGPVAAHERVEAARAAGVELRASTAALAYYAE
DPQPVLVAASPDSALRLRPQQTVWATGAYAVNAPFVNNDRPGVFAARAVGRLLVQYRVKP
GHRVCIADTGADAYAALLGRALEDAGCEVVRVGGADADSERGERLVRVLGARGHAWVEGA
EVEDARGRSRRIECDIIAVAATPAPASEGPRQHGCQVAYASAAGGFAVQADEFGRAGPSG
VWACGDVCGYQGPERAAERGAEVGAAAAEAVP
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgcgtctgcccattctcgataccgcacccgcatgggcgcgaagagaaactccg
gttcagctccgactcgacggtgacccggtccgcggctacgccaatgagagcgtcgccgtc
ggcctctacgccagcggccaccgcgtgctctcgcgctccatcaagtaccaccggccgcgc
gccttcttctgcctcgagggccactgcggcggctgcctgatgcgcatcgacggcgtgccc
aaccagcgcgcgtgtcagcagccgtgccgcgagggcctgcgcctggagccgcagaacgcc
tacccctccgccgacctcgacgtgctcgaggccgtggactggctgttcccgggcggcatg
aaccatcacaccctgatgaccggctcgccgctgctcaacgccgtggccaacaagatcgtc
cgcaagctcagcggcctcggcgaggcgcccacggccccgcctgcgcgcctgccccgggcc
gaggagctggcgcccgaggtgctcgtggtcggcggcggccccgcgggactgaccgcggcc
acggcggccgcacgcggcggcgcgcgcaccctgctgatcgaggagcagccggtgctcggc
ggcagcctgctcgccgacccgcgcttcggcccggtcgcggcccatgagcgggtcgaagcc
gcgcgcgccgccggggtcgagctgcgggcgagcaccgcggccctggcctactacgccgaa
gatccccagccggtgctggtcgcggcctcgcccgatagcgccctgcgcctgcgcccgcag
cagaccgtgtgggccaccggcgcctacgcggtcaacgcgcccttcgtcaacaacgaccgc
ccgggcgtattcgccgcgcgcgcggtcggccgcctgctggtgcagtaccgggtcaagccc
ggccatcgagtgtgcatcgccgataccggcgccgacgcctacgccgccctgctcggccgc
gcgctcgaggacgccggctgcgaggtcgtgcgcgtcggcggcgccgatgccgacagcgag
cgcggcgagcgcctggtgcgcgtgctcggcgcgcgcggccacgcctgggtcgagggcgcc
gaggtcgaggacgcgcgcggccgcagccggcgcatcgagtgcgacatcatcgcggtcgcg
gccacgcccgcgccggcctccgagggcccgcgccagcacggctgccaggtcgcctacgcc
agcgcggccggcggctttgccgtccaggcggacgaattcggacgcgccggccccagcggc
gtgtgggcgtgcggcgacgtgtgcggctaccagggccccgagcgcgcagccgagcgcggc
gccgaggtcggcgcagcggccgcggaggcggtgccgtga

DBGET integrated database retrieval system