KEGG   Haliangium ochraceum: Hoch_3268Help
Entry
Hoch_3268         CDS       T01103                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00010  Glycolysis / Gluconeogenesis
hoh00051  Fructose and mannose metabolism
hoh00562  Inositol phosphate metabolism
hoh01100  Metabolic pathways
hoh01110  Biosynthesis of secondary metabolites
hoh01120  Microbial metabolism in diverse environments
hoh01130  Biosynthesis of antibiotics
hoh01200  Carbon metabolism
hoh01230  Biosynthesis of amino acids
Module
hoh_M00002  Glycolysis, core module involving three-carbon compounds
hoh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hoch_3268
   00051 Fructose and mannose metabolism
    Hoch_3268
   00562 Inositol phosphate metabolism
    Hoch_3268
Enzymes [BR:hoh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hoch_3268
Exosome [BR:hoh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hoch_3268
  Exosomal proteins of bladder cancer cells
   Hoch_3268
  Exosomal proteins of melanoma cells
   Hoch_3268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACY15770
UniProt: D0LTS6
Position
complement(4504518..4505291)
Genome map
AA seq 257 aa AA seqDB search
MSKRTPIVVGNWKLNKTVTEALSLVTDLKNQLGAVRDVEIGVAPVFPALHPVAKRLEDSN
VGVAGQNCFWEESGAFTGEVSPAQLADVGCRYVIIGHSERRQYFGETDETVGKKARAAID
AGLIAIICMGEREHERDGGHTFERIDAQLTGALTPLKSEDLERVVLAYEPVWAIGTGRTA
TPAQAQEVHAHIRTRLRERFGEVADSVRIQYGGSVKPGNAEALLREADIDGGLIGGASLK
ADDFVAIVKAARLATNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcgcacgcccatcgtcgtcggcaactggaagctcaacaagaccgtgaccgag
gccctgtctctggtcaccgatctcaagaaccagctcggcgcggttcgcgatgtcgagatc
ggcgtcgccccggtcttccccgccctgcaccccgtggccaagcgcctcgaggacagcaac
gtcggcgtcgccggccagaactgcttctgggaggagagcggcgcgttcaccggcgaggtg
tccccggcgcagctcgccgatgtcggctgccgctacgtcatcatcggccacagcgagcgc
cgccagtacttcggcgagaccgatgagaccgtcggcaagaaggcgcgcgcggccatcgac
gccggcctcatcgccatcatctgtatgggcgagcgcgagcacgagcgcgacggcggccac
accttcgagcgcatcgatgcccagctcacgggcgcgctcacgccgctcaagagcgaggac
ctcgagcgcgtggtcctggcctacgagccggtgtgggccatcggcaccggccgcaccgcg
accccggcgcaggcccaggaggtacacgcgcacattcgcacccggctgcgcgagcgcttc
ggcgaggtcgccgacagcgtgcgcatccagtacggcggctcggtcaaacccggcaacgcc
gaggcgctgctgcgcgaggccgacatcgacggcggtctgatcggcggagcctcgctcaag
gccgacgacttcgtggccatcgtcaaggccgcgcgtcttgcaacgaacgcctaa

DBGET integrated database retrieval system