KEGG   Haliangium ochraceum: Hoch_3582Help
Entry
Hoch_3582         CDS       T01103                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hoh01100  Metabolic pathways
hoh01110  Biosynthesis of secondary metabolites
hoh01130  Biosynthesis of antibiotics
hoh01230  Biosynthesis of amino acids
Module
hoh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hoch_3582
Enzymes [BR:hoh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Hoch_3582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACY16084
UniProt: D0LX42
Position
4935629..4936420
Genome map
AA seq 263 aa AA seqDB search
MSILARILERKRDELADAKRLRPFAALADQAASAPPTRGFASALRRPDGAPVRVIAEIKR
ASPSAGPIRPGADPADIGAMYQAAGAAAISVLTDESFFDGHLDFLARVRAVTEVPLLRKD
FLIDPYQVVEARAAGADAVLLIVAALEHELLAQLLAEARTYGLDALVEVHDADEAERAVA
AGAEIIGVNHRNLRTFEVDTGLTAQLRPLLPKDAIAVGESGVRSAADVRRLGEAGADAVL
VGERLMRESHPGEALAALMGIGA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatcctggcccgcatcctcgagcgcaaacgcgacgagctggccgacgccaagcgc
ctgcggccgttcgcggcgctcgccgaccaggccgcgagcgcgccgcccacgcgcgggttt
gccagcgcgctgcggcgccccgatggcgccccggtgcgcgtcatcgccgagatcaagcgg
gcctcgccctcggccggccccatccgccccggcgccgaccccgcggacatcggcgccatg
taccaggccgccggcgccgccgccatctcggtgctcaccgacgagtccttcttcgacgga
cacctcgactttctcgcccgcgtgcgcgcggtcaccgaggtgccgctgctgcgcaaggac
ttcctcatcgacccctaccaggtggtcgaagcccgcgccgccggcgccgacgccgtgctg
ctgatcgtcgccgcgctcgagcacgagctcttggcccagctcctggccgaggcccgcacc
tacggactcgacgccctggtcgaggtccacgacgccgacgaggccgagcgcgcggtcgct
gccggcgccgagatcatcggcgtcaaccaccgcaacctgcgcaccttcgaggtcgatacc
ggcctcaccgcgcagctccgtccgctgctgcccaaagacgccatcgcggtcggcgagagc
ggcgtgcgctcggccgccgatgtgcgccgcctgggcgaggccggcgccgatgccgtgctc
gtgggcgaacgcctgatgcgcgagtcccatcccggcgaggcgctcgccgcgctgatgggc
atcggcgcatga

DBGET integrated database retrieval system