KEGG   Haliangium ochraceum: Hoch_3740Help
Entry
Hoch_3740         CDS       T01103                                 

Definition
(GenBank) stationary-phase survival protein SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00230  Purine metabolism
hoh00240  Pyrimidine metabolism
hoh00760  Nicotinate and nicotinamide metabolism
hoh01100  Metabolic pathways
hoh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hoh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Hoch_3740
   00240 Pyrimidine metabolism
    Hoch_3740
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Hoch_3740
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     Hoch_3740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: ACY16240
UniProt: D0LY90
Position
complement(5143691..5144533)
Genome map
AA seq 280 aa AA seqDB search
MQAQAMKPLVLLSNDDGIGSPYLQALADALDATGEVETLVVAPERQRSAASHAITLHKPL
RLHKHGERRFSLSGTPVDCVYVGLIKLAERAPALVLSGINRGYNLGLDVFYSGTVAAAVE
GGLRGVPAIALSLAPEERADLQSALRFSVALALQVVANPLPPLTVLNVNFPVQPDERWAW
TGLGKRAYEDDVHERFDPRGQPYYWIGGGSAELGDDRCTDCAAIGAGITTVTPLRLNLSG
HGLLGADAASEHGWSPAGYRLVPEASQVPEAPKVRSDGAE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcccaagccatgaagccgctggttctactctccaacgacgacggcatcggctct
ccgtacttgcaggcgctcgccgacgcgctcgatgccacaggcgaggtcgagaccttggtg
gtcgcgcccgagcgccagcgctccgcggcctcgcacgcgatcacgctgcacaagccgctg
cggctgcacaaacacggcgagcggcgcttctcgctcagcggcacgccggtcgattgcgtg
tacgtcgggctcatcaagctcgccgagcgcgcgccggcgctggtgctctccggcatcaat
cgcggctacaacctcggtctcgacgtcttttactcgggaacggtggccgcggccgtcgag
gggggtctgcgcggtgtgcccgcgatcgcgctgtcgctcgcgcccgaggagcgcgctgat
ctgcagtcggcgctgcgcttctccgtcgcgctggcgctgcaggtggtggccaacccgctg
ccgccgctcacggttctcaacgtcaattttcccgtccagccggacgaacgctgggcgtgg
acgggtctcggcaagcgcgcctacgaggacgatgtgcacgagcgcttcgacccgcgcggc
cagccgtactactggatcggtggcggcagcgcggagctcggcgacgatcgctgcaccgac
tgcgccgccatcggcgccggcatcaccacggtgaccccgctgcggctcaacttgtcggga
cacggcctgctgggcgccgacgcggcgagcgagcacggatggtcgccggcgggctatcgc
ctggtgcccgaggcgtcccaggtgcccgaggcgcccaaggttcggagcgacggggcggag
tag

DBGET integrated database retrieval system