KEGG   Haliangium ochraceum: Hoch_4000Help
Entry
Hoch_4000         CDS       T01103                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hoh  Haliangium ochraceum
Pathway
hoh03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hoh00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Hoch_4000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hoh03011]
    Hoch_4000
Ribosome [BR:hoh03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Hoch_4000
  Bacteria
    Hoch_4000
  Archaea
    Hoch_4000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Plant_vir_prot
Motif
Other DBs
NCBI-ProteinID: ACY16499
UniProt: D0LIC0
Position
complement(5494864..5495208)
Genome map
AA seq 114 aa AA seqDB search
MQARAVVKHISMSPRKMRVVANMVRGERVEEALASLRFMPKKAARLIAKALESAAANAED
KSGGDVDIDSLVIEGIYVDGGPIIKRWMPRAMGRANRINHRTSHLTVVVGDGND
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgagagcagtcgtcaaacatatctcaatgtccccgcgcaagatgcgcgtggtg
gcgaacatggtgcgcggagagcgcgtcgaggaggcgctggcctccctgcgcttcatgccg
aagaaggctgcccgcctcatcgccaaggcgctggagtcggctgccgcaaacgccgaggac
aagtccggcggtgacgtcgatatcgattcgctggtcatcgagggcatctacgtggacggc
ggacccatcatcaagcgctggatgccgcgggccatgggtcgggcaaaccgcatcaatcac
cgcaccagccacctcacggtggtcgtcggtgatggcaacgactga

DBGET integrated database retrieval system