KEGG   Haliangium ochraceum: Hoch_5137Help
Entry
Hoch_5137         CDS       T01103                                 

Definition
(GenBank) Exodeoxyribonuclease V
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hoh  Haliangium ochraceum
Pathway
hoh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Hoch_5137
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Hoch_5137
DNA repair and recombination proteins [BR:hoh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Hoch_5137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD UvrD-helicase PhoH AAA_22 DUF2075 AAA_16 DEAD T2SSE UvrD_C CbiA PXA
Motif
Other DBs
NCBI-ProteinID: ACY17625
UniProt: D0LWH5
Position
7075721..7077970
Genome map
AA seq 749 aa AA seqDB search
MKRSWLQISPRGTARERYEQRVGLAPLASAAAAETSADSDAAAASEAERDAGERERLASF
FRNVAAGAHAHDLGDESLYLAEELAELQWSLAGRHKRAVALLALATMISARQGSSRLPID
LAPDGYLARLLGSLLSAGEMQLAPAEVLRDIEALPRLPALDKVIGRPGEYRPLIFSDGCI
YQHRMLWCEDQLAARLRERLGGARDDTSMAGRAAPRTTAGTAAGAAGDSAGAVAGDAASE
DAASAALAAVLARPAMVGADAVVLSDEQAAAVRAATRQRFCVISGGPGTGKTAIVVTILR
TLARLGESPESALLAAPTGKAANRMGSSIRSALLAVPDPDPVDRQLLERASEPQTLHRLL
GYVPVLDRFRQHENNPLRARTVIVDEASMIDAELMERLLRAVPSETRLVLLGDADQLPSV
DAGAVLRDLVAAGTGDDGGFARRLTHSYRMDVRDPAGRAILGAAQAMNRGETALALPIRR
AAKELQWHGIELLDTVGATGATEGTTAPAADIAAVNDFVDHWYDKRIASDREFARLSTKT
FQRHDDAFTPEDAADLRALMSIYERSRLLTVTRRYDTGAEAINRRLHRRVITAASVDYGP
DFYPGEPVMMRRNDYERGLFNGDQGVVVRVSENGEPQRFRLAFARGEEFAVFSLDALRMH
VELAFAMTVHKSQGSEFSEVALVLPLEAIPLATREMLYTGVTRARRAVVLVGAPALLRTA
IAQRGERFSGLADKLAPAPDGAAYAEVRG
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttcctggttacagatctcgccgcggggcaccgcgcgcgagcgctacgagcag
cgcgtgggtctggcgccgctggcgtcggccgcggctgccgagacgagtgccgatagcgac
gccgccgcagcgagcgaagccgagcgcgacgccggcgagcgcgagcgcctggcgagcttc
ttccgcaatgtcgccgcgggcgcccacgcccacgatctcggcgacgagagcctgtatctg
gccgaggagctggccgagctgcagtggtcgctggccggccgtcacaaacgggcggtggcg
ctgctcgcgctggcgaccatgatcagcgcgcgccagggctccagccggctgcccatcgac
ctcgcccccgacggctatctcgcgcgcctgctgggctcgctgctcagcgccggcgagatg
cagctcgcgcccgccgaggtgctgcgcgatatcgaggccctgccgcggctgcccgcgctc
gacaaggtgatcggacgaccgggcgaataccggccgctgatcttcagcgacggctgcatc
taccagcaccgcatgctgtggtgcgaggaccagctcgccgcgcggctgcgcgaacggctg
ggcggcgcgcgcgacgacacatcgatggccggccgggcggcgcccaggacgacagcgggg
acagcagccggcgcggcgggcgacagcgcgggcgcggtggccggcgacgcagcgagcgag
gacgcggcgtcggccgcgctcgcggccgtgctcgcccgcccggccatggtcggcgcggat
gccgtcgtgctgtccgacgaacaggcggccgcggtgcgcgcggccacccggcagcgcttc
tgcgtcatctccggcggccccggcaccggcaagaccgccatcgtggtgaccatcctgcgc
accctcgcgcgtctgggcgaatcgcccgagagcgcgctcctggccgcgcccacgggcaaa
gccgccaaccgcatgggcagctcgatccgctcggcgctgctggcggtgcccgaccccgac
ccggtcgatcgccagctcctcgagcgcgccagcgagccgcagaccctgcaccgcctgctc
ggctacgtgccggtcctcgatcgctttcgccagcacgagaacaacccgctgcgggcgcgc
acggtcatcgtcgacgaggcgtccatgatcgacgccgagttgatggagcgcctgctgcgc
gcggtgccgtccgagacccgcctggtgctgctcggcgacgccgaccagttgccctcggtc
gacgccggcgcggtgctgcgcgatctggtcgccgcgggcacgggtgacgacggcggcttt
gcccgcaggctcacccacagctatcgcatggacgtgcgcgaccccgccggccgcgccatc
ctcggcgccgcccaggccatgaaccgcggcgagaccgcgctggccctgcccatccgacgc
gcggccaaggagctacagtggcacggcatcgagctgctcgataccgtcggcgccaccggc
gccaccgagggcacgacagcccccgccgccgacatcgccgcggtcaacgactttgtcgac
cactggtacgacaaacgcatcgccagcgaccgcgaattcgcgcgcctcagcaccaagacc
ttccagcgccacgacgacgcctttacacccgaggacgccgccgatctgcgcgcgctgatg
agtatctacgagcgcagccggctgctcaccgtgacccgccgctacgacaccggcgccgag
gccatcaaccgccgcctgcaccgccgcgtcatcaccgcggcctcggtcgactacggcccc
gacttctaccccggcgagccggtgatgatgcgccgcaacgactacgagcgcggcctgttc
aacggcgaccagggcgtggtcgtgcgcgtgtccgaaaacggcgagccgcagcgcttccgc
ctggcctttgcgcgcggcgaggagttcgccgtgttctcgctcgacgccctgcgcatgcac
gtcgagctggcgttcgcgatgacggttcacaagagtcagggctcggagttctccgaggtc
gccctggtgctgccgctcgaggccatcccgctggcgacgcgcgagatgctgtacacgggc
gtcacccgcgcccgccgcgccgtggtcctggtgggcgcgcccgcgctgctgcgcacggcc
atcgcccagcgcggcgagcgcttctcggggctggccgacaagctcgcgcccgcgcccgat
ggcgccgcctacgccgaggtccgcggatga

DBGET integrated database retrieval system