KEGG   Haliangium ochraceum: Hoch_5253Help
Entry
Hoch_5253         CDS       T01103                                 

Definition
(GenBank) CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
hoh  Haliangium ochraceum
Pathway
hoh02020  Two-component system
hoh02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hoch_5253
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Hoch_5253
Enzymes [BR:hoh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Hoch_5253
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Hoch_5253
Two-component system [BR:hoh02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Hoch_5253
Bacterial motility proteins [BR:hoh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Hoch_5253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest zinc-ribbons_6 Zn_ribbon_recom
Motif
Other DBs
NCBI-ProteinID: ACY17738
UniProt: D0LXI3
Position
complement(7219788..7220816)
Genome map
AA seq 342 aa AA seqDB search
MSQSRDTIVIGTSSGGVSALRTLLGQLDSALPAAVLIVQHLSPRSPGQLVAVLQRATSMP
VAWVDEPVEIRPGHVYVYVAPPDMHLTIREDRAEVVRGPRENRARPAINPLFRTAAAERG
GRVIAVLLTGLLDDGIAGLESVRRCGGVTVVQDPDDAEFAEMPQRALSAELADHVCCLAG
MGALLRTLVGQPAPASEVPHAITVEARMSGPGRSTPEALTSIGDQVPASCPECGGPLWAV
GAGESSVYRCHTGHALSARALLEMQAEEVERSMWAAVRALTERAAVLERMAGDAEARGHH
RGGDVFRERAREDWAHSEQARQYLLSLRENLPREPEATGTRE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgagccagagccgcgataccatcgtcattggcacctcgtcgggcggggtgagcgcgctg
cgtacactgctcggccaactcgactccgcgctgccggctgcggtgttgatcgttcagcat
ctgtcgccgcgcagcccgggccagctcgtcgccgtgctccagcgggccacgagcatgccc
gtcgcctgggtcgacgaaccggtcgaaatccggcccggccacgtgtacgtgtacgtggcg
ccgcccgacatgcatctcacgatccgcgaggatcgcgctgaagtggtccgcggaccgcgc
gagaaccgcgcgcgtcccgccatcaatccgctgttccgcaccgcggcggcggagcgcggt
ggtcgggtcatcgcggtgctgctcaccggcctgctcgacgacggcatcgccgggctggag
tcggtgcgccgctgcggcggtgtgaccgtggtgcaagatccggatgacgctgagttcgcc
gagatgccgcagcgggcgctgagcgcggagctcgccgatcacgtctgctgcctggccggg
atgggcgcgctcttgcgcacgctggtcggccagcccgcgcccgcgagcgaggtgccgcac
gccatcaccgtcgaggcgcgcatgagcgggccggggcggagcacgccggaggcgcttacc
agtattggcgatcaggtgcctgcgtcgtgccccgagtgcggagggccgctgtgggcggtg
ggcgcgggtgagagttcggtgtatcgctgccacacgggccacgcgctgtcggcgcgcgcg
ttgctcgagatgcaggccgaagaggtcgagcggtcgatgtgggcggcggtgcgcgccctg
accgaacgcgccgcggttctcgaacgcatggccggcgacgccgaggcccgcggtcaccat
cgcggcggtgacgtatttcgcgagcgggcgcgcgaggactgggcgcactccgagcaggcg
cggcagtatctcttgtcactgcgcgagaacctgccgcgcgagcccgaagcaactgggaca
agagaatga

DBGET integrated database retrieval system