KEGG   Haliangium ochraceum: Hoch_5550Help
Entry
Hoch_5550         CDS       T01103                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00040  Pentose and glucuronate interconversions
hoh00052  Galactose metabolism
hoh00500  Starch and sucrose metabolism
hoh00520  Amino sugar and nucleotide sugar metabolism
hoh01100  Metabolic pathways
hoh01130  Biosynthesis of antibiotics
Module
hoh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Hoch_5550
   00052 Galactose metabolism
    Hoch_5550
   00500 Starch and sucrose metabolism
    Hoch_5550
   00520 Amino sugar and nucleotide sugar metabolism
    Hoch_5550
Enzymes [BR:hoh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Hoch_5550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ACY18033
UniProt: D0LZQ4
Position
complement(7618139..7619035)
Genome map
AA seq 298 aa AA seqDB search
MSPSRPPIRKAVIPAAGLGTRFLPATKAIPKEMLPIVDKPTIQLVVEEAVAAGMEDIVII
NGRQKVAIEDHFDHAFELEHTLRERSKDELLALSEQVSTMVRMVSVRQKRPLGLGHAVLC
ARPAVGEEPFAVLLGDDLIDCDEAPGIGQLAEVYARTGAGAVAVMEVQPGEEKLYGILDA
EPMEDGLLRVRDMVEKPDPKDAPSRMAVIGRYVLPPEIWPILAEVKPGVGGEIQLTDALR
ELARGDGPGLIGVPIRGTRHDAGNKLGYLGANLAYALKRPELRDDVLALMRSLLDAEK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgagcccttcccgacctcccattcgcaaggccgtgatcccggccgccggcctgggcacg
cgctttctgcccgccaccaaggccatccccaaagagatgttgcccatcgtcgacaagccg
acgatccagctcgtcgtcgaggaggcggtggctgccgggatggaggacatcgtgatcatc
aacggccgccagaaggtggccatcgaggatcatttcgaccacgccttcgagctcgagcac
acgctgcgcgagcgcagcaaggacgagctcttggcgctgtccgagcaggtgtcgacgatg
gtgcgcatggtctcggtgcggcagaagcggccgctgggcctgggccacgcggtgctgtgc
gcgcgtccggccgtgggcgaggagcccttcgccgtgctgctcggcgacgatctcatcgac
tgcgatgaggcccccggtatcggccagctcgccgaggtctacgcgcgcacgggcgccggc
gccgtggccgtgatggaggtgcagccgggcgaggagaagctctacggcatcctcgacgcc
gagcccatggaagacggcctgctgcgcgtgcgcgacatggtcgagaaacccgatcccaag
gacgcgccctcgcgcatggccgtgatcggacgctacgtcctgccgcccgagatctggccc
atcctggccgaggtcaagcccggcgtcggcggcgagatccagctcaccgacgcgctgcgc
gagctggcccgcggcgacggccccggcctcatcggtgtgcccatccgcggcacccgccac
gacgccggcaacaagctcggctacctgggcgccaacctggcctacgcgctcaagcggccc
gagctgcgcgacgacgtgctggcgctgatgcgctccctgctcgacgccgagaagtag

DBGET integrated database retrieval system