KEGG   Haliangium ochraceum: Hoch_5842Help
Entry
Hoch_5842         CDS       T01103                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00230  Purine metabolism
hoh01100  Metabolic pathways
Module
hoh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hoh00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Hoch_5842
Enzymes [BR:hoh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Hoch_5842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 Thymidylate_kin AAA_22 AAA_16 Zeta_toxin MobB Tape_meas_lam_C cobW TsaE
Motif
Other DBs
NCBI-ProteinID: ACY18318
UniProt: D0LIG2
Position
complement(8021172..8021951)
Genome map
AA seq 259 aa AA seqDB search
MSQPSSPTDAERPPQRGILIVLSSPSGAGKTTLAHRLLAEFPSVSFSVSLTTRPPRAGEL
DGVDYHFVDRGRFDTLVDEGALAEWAEVHGNCYGTSRDAVEDALTGGRDMLFDIDWQGGQ
ALAARWPEDVLKVFVFPPSLEVLASRLRGRGTDEAEVIQGRLQRAVAEMQHFSEYDHLVV
NDDLDAAYAALRAIYLVRKHGLVRKHGAEAGAGVAHDLPSLAALARQCEVGAMAKRARGI
IMGEHADPHAKAAADDPRK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccgtcttcccccaccgatgccgagcgcccgccccagcgcggcatcctcatc
gtcctgtcctcgccctcgggcgcgggcaagaccacgctggcccaccgcctgctcgccgaa
tttccctcggtctcgttctcggtgtcgctgaccacccggccgccgcgggcgggcgagctc
gacggcgtcgactatcacttcgtcgaccgcggccgcttcgacaccctggtcgacgaaggc
gccctggcggagtgggccgaggtccacggcaactgctacgggacctcgcgcgacgcggtc
gaggacgcgctcaccggcggccgcgacatgctcttcgacatcgactggcagggcggccag
gcgctggccgcgcgctggcccgaggacgtgctcaaggtgttcgtgtttccgcccagcctc
gaggtcctggcttcccggctgcgcggtcgcggcaccgacgaggccgaggtgatccagggc
cgcctgcagcgcgcggtcgccgagatgcagcacttctcggaatatgaccacctggtcgtc
aacgacgacctcgacgccgcctacgctgccctgcgcgctatctacctggtccgcaaacac
ggcctggtccgcaaacacggcgccgaggcgggcgccggggtcgcgcacgacctgccgagt
ttggccgcgctcgcacggcaatgcgaagtcggcgctatggccaagcgcgcgcgcgggatt
atcatgggggaacatgccgacccccacgccaaagccgccgccgacgacccgcgcaagtga

DBGET integrated database retrieval system