KEGG   Haliangium ochraceum: Hoch_6074Help
Entry
Hoch_6074         CDS       T01103                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00520  Amino sugar and nucleotide sugar metabolism
hoh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Hoch_6074
Enzymes [BR:hoh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Hoch_6074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 adh_short NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ACY18549
UniProt: D0LL53
Position
complement(8317432..8318367)
Genome map
AA seq 311 aa AA seqDB search
MRTLVTGGAGFIGSHLCERLLDDGHEVVCADNFYTGSEDNIAHLRARPGFTLLRHDVVEP
VPCEAERIYHLACPASPVHYQRDPVKTIQTSVLGAMHLLEQCRVTGARLLIASTSEVYGD
PTVHPQSESYWGHVNPIGPRACYDEGKRVAETLCFDYQRRDGVDIRVVRIFNTYGPRMAM
NDGRVVSNFVVQALRGEPLTIYGDGNQTRSFCYVDELVEGMVRMMNQDADTGPVNLGNPA
EYTIRELAERVLTLTGSSSRVMHQALPADDPVRRKPDIARARTLLEWTPRISLEQGLERT
IAYFRELLGYE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgctggtcacgggcggtgcgggcttcatcggctcgcacctgtgtgagcgcctc
ctcgacgacgggcacgaggtggtgtgcgcggataacttttacaccggcagcgaagacaac
atcgcgcacctgcgggcgcgccctggcttcacgctgctgcgccatgacgtggtcgagccc
gtgccctgcgaggccgagcggatctaccacctggcgtgtcccgcgtcgcccgtgcactac
cagcgcgatccggtcaagaccatccagacctcggtcctgggcgccatgcatctgctcgag
cagtgccgggtcacgggcgcgcgcctgctcatcgcctcgaccagcgaggtctacggcgat
cccaccgtgcatccgcagtccgagagctactgggggcacgtcaatcccatcggtccgcgc
gcctgctacgacgagggcaagcgcgtggccgagaccctgtgcttcgactaccagcgccgc
gacggcgtcgacatccgcgtggtgcgcatcttcaacacctacgggccgcgcatggcgatg
aacgacggccgcgtggtgtcgaatttcgtggtccaggcgctgcgcggcgagccgctgacg
atctacggcgacggcaaccagactcgctccttctgctacgtcgacgagctggtcgagggc
atggtgcggatgatgaaccaggacgcggacaccggtccggtcaacctcggcaacccggcc
gagtacaccatccgcgagctggccgagcgcgtgctcacgctcaccggcagcagcagccgg
gtgatgcaccaggccctgccggccgacgatccggtgcgtcgcaaacccgacatcgcccgc
gcgcgcacgctgctcgagtggacgccgcggatctcgctcgagcagggcctcgagcggacc
atcgcctacttccgcgagctgctcggctacgagtga

DBGET integrated database retrieval system