KEGG   Haliangium ochraceum: Hoch_6855Help
Entry
Hoch_6855         CDS       T01103                                 

Definition
(GenBank) transferase hexapeptide repeat containing protein
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
hoh  Haliangium ochraceum
Pathway
hoh00520  Amino sugar and nucleotide sugar metabolism
hoh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Hoch_6855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hoh01005]
    Hoch_6855
Enzymes [BR:hoh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     Hoch_6855
Lipopolysaccharide biosynthesis proteins [BR:hoh01005]
 Unusual sugar
  Hoch_6855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 PAAR_motif
Motif
Other DBs
NCBI-ProteinID: ACY19319
UniProt: D0LUJ6
Position
complement(9390556..9391149)
Genome map
AA seq 197 aa AA seqDB search
MAAPDYYVHPSAVVDPGARIGPGTKIWHFAHVMSGAVIGGGCVVGQGCYIGNVRIGERVR
IQNNVSVYDGVTLEDDVFAGPSCVFTNVLNPRAEVERKHEFRPTLVRRGATIGANATIVC
GAVLEPYAFIGAGAVVRGEVAAHALMVGVPARRIGWMCACGERLDQAAAAGNYACAACGR
EYARIGDGLAALRSPGA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacctgactactacgtccacccctcggccgtggtcgatcccggcgcccgcatc
ggccccggcaccaagatctggcacttcgcgcacgtgatgtcgggcgccgtcatcggcggc
ggctgcgtggtcggccagggttgctacatcggcaacgtgcgcatcggcgagcgcgtgcgc
atccagaacaacgtgtcggtgtacgacggcgtcaccctcgaggacgacgtcttcgccggg
ccgagctgcgtgttcaccaacgtcctcaacccgcgcgccgaggtcgagcgcaagcacgag
tttcggcccacgctggtgcgccgcggcgccaccatcggcgccaacgcgaccatcgtatgc
ggcgcggtgctcgagccctacgcgttcatcggcgccggcgccgtggtccgcggcgaggtc
gccgcccacgcgctcatggtcggcgtgccggcgcgccgcatcggctggatgtgcgcctgc
ggcgagcgcctggaccaagccgcggccgcgggcaactacgcgtgcgcggcctgcgggcgc
gagtacgcgcgcatcggcgacgggctggccgcgctcaggtctcctggcgcgtga

DBGET integrated database retrieval system