KEGG   Halothermothrix orenii: Hore_09810
Entry
Hore_09810        CDS       T00838                                 
Name
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
hor  Halothermothrix orenii
Pathway
hor00230  Purine metabolism
hor01100  Metabolic pathways
hor01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:hor00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Hore_09810
Enzymes [BR:hor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Hore_09810
SSDB
Motif
Pfam: Guanylate_kin AAA_18 AAA_17 RsgA_GTPase AAA_33 NTPase_1 AAA_16 AAA_29 Rad17 ABC_tran AAA_22 RNA_helicase
Other DBs
NCBI-ProteinID: ACL69737
UniProt: B8CWR8
Position
1070615..1071199
AA seq 194 aa
MGKGKLFVLSGPSGVGKGTVLDKLLSDFKDVQYSVSATTRKPRPGEKDGVDYFFLSREKF
FKMVENNEFIEWAEVHNNYYGTPKIFVDKCLAEGKDVILEIDIQGARQVKKLYPDAIFIF
LVPPSLNELKRRLNHRGSEDEKNMKIRLNNAEDELKEVKNYDYKVVNDRLDDAVEKLKSI
IIAEKCKIREEDCQ
NT seq 585 nt   +upstreamnt  +downstreamnt
atgggaaaggggaaactttttgtactgtcaggtccttctggtgtaggtaaagggacggtt
ttagataaattattatctgattttaaagatgtccagtactctgtttctgccactacaaga
aaacccagaccgggggagaaagatggagtagattacttttttctcagccgtgagaagttt
tttaaaatggttgagaataatgaatttatcgaatgggccgaagtccataataattattac
ggaactcctaaaatatttgtagataaatgcctggctgagggtaaagatgttattctggaa
atagatattcagggggcacgccaggtcaaaaagctctaccccgatgccatctttattttt
ttggttcccccgtctcttaatgaattaaaaaggcgtttaaatcatcgtggttcagaagat
gaaaaaaatatgaaaatcaggttaaataatgctgaagatgaattaaaagaggttaaaaat
tatgattataaagttgttaatgaccggcttgatgatgctgttgaaaaattaaaatctata
attatagctgaaaaatgtaaaataagggaggaggattgtcaatga

DBGET integrated database retrieval system