KEGG   Halothermothrix orenii: Hore_23170
Entry
Hore_23170        CDS       T00838                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
hor  Halothermothrix orenii
Pathway
hor00620  Pyruvate metabolism
hor00640  Propanoate metabolism
hor00650  Butanoate metabolism
hor01100  Metabolic pathways
hor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Hore_23170
   00640 Propanoate metabolism
    Hore_23170
   00650 Butanoate metabolism
    Hore_23170
Enzymes [BR:hor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Hore_23170
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029
Other DBs
NCBI-ProteinID: ACL71062
UniProt: B8D1B0
Position
complement(2530506..2532725)
AA seq 739 aa
MAYNFKAGRWQKEIDVRDFIQQNYTPYTGDSSFLEGPTDRTRQLWEECQKLLWQEIEEGG
VLDIDVDTVSDINAYEAGYINRDLEKIVGLQTDKPLKRTLNVYGGIRMARQAAEAYGYKV
NEQIEKVFNNYRKTHNDGVYDVYTPELREIRRSGVITGLPDAYGRGRIIGDYRRVALYGI
DRLIEEKEKDLAHLPTRMTEENVRLREELSEQIKALKKLKGLGRTYGLELSRPARTAHEA
IQWTYMGYLAAIQENNGAAMSLGRVCEFFDIYIEHDLRKGKLTEEEAQELIDDFVIKLRL
ARQLRTPEYNKLFSGDPMWITVVIGGTGIDGRPLVTKTSFRILNTLYNLGPAPEPNLTVL
WSRRLPDGFKEFCCRVSRDTSSIQYENDELMREYYGDDYAIACCVSALRTGKEMQFFGAR
CNLPKTLLYALNGGRDELSGVQVGPEFAPYTGDILEYDLVMERFDTFLDWLVEKYVDALN
IIHYMHDKYAYERVQMALMDTEVDRVMGFGIAGLSIVADSLSAIKYAKVRPVRNSDGLIT
SFDVEGDHPRYGNDDDRVDSLAVEVVRRFLTKLKQHKLYRNARHTLSILTITSNVVYGTK
TGATPDGREAGQPFAPGANPMHGRDESGALASLNTVAKLPYEYCQDGISNTFTIVPGALG
VNEEQRINNLVAILDGYFTKGGHHLNVNVLNRETLLDAVNHPEKYPQLTIRVSGYAVNFI
KLTPEQQQEVIARTFHESL
NT seq 2220 nt   +upstreamnt  +downstreamnt
atggcctataactttaaagcaggaagatggcaaaaagagattgatgtccgggattttatt
cagcaaaattatactccatatacaggggatagttcttttttagagggtccaaccgaccgg
acaagacaactctgggaagagtgtcaaaaactattatggcaggagattgaagagggaggg
gtgctggatatcgatgtcgatactgtatccgatattaacgcctatgaggccgggtatatt
aaccgtgacctggagaagattgtcggcctgcagaccgataaacccctgaaacggaccctc
aatgtctatggtggtataaggatggcccggcaggcggcagaggcctacgggtataaggtt
aatgagcagatcgaaaaagtatttaacaactacaggaaaacccataatgatggggtttat
gatgtctatacccccgaattacgggagataaggcgttccggggtaattactggcctgccc
gatgcctatggccggggacggattatcggggattaccgacgggtggccctttacggtatt
gacaggttaatcgaggagaaagaaaaggacctggcccatcttcccaccaggatgaccgaa
gaaaatgtcaggctgcgggaggagttaagtgaacagatcaaggccctgaaaaaacttaaa
ggcctgggtagaacatacggcctggaactttcacggccggcccggactgctcacgaggcc
atccagtggacctatatgggatacctggctgccattcaggaaaacaacggggctgctatg
tcccttggccgggtatgcgagttttttgatatctatattgaacatgacctcaggaaaggg
aagttaacagaggaagaggcccaggaattaatcgatgattttgtcatcaagctcaggctg
gcccggcagctacggactcctgaatacaataaactcttcagtggggatcccatgtggatt
acggttgtcatcggtggtactggtatagacggacgccccctggtaacaaagaccagcttc
aggattttaaataccctgtataacctcggaccggctccggaacccaacctcaccgttctc
tggtcccggagattaccggatgggtttaaggagttctgttgccgggtatcacgggatacc
agttctattcagtatgaaaatgatgaattgatgagggaatattacggggatgattatgcc
attgcctgctgtgtatcagccctcaggaccgggaaagagatgcagttcttcggggccagg
tgtaacctgcccaagaccctcctgtatgccctcaatggtggccgggatgaattaagtggg
gtccaggtggggcccgaatttgccccatacaccggagatatacttgagtatgacctggtc
atggagaggtttgataccttcctcgactggctggtggaaaaatatgttgatgccctcaat
attatccactatatgcatgacaaatatgcctatgaacgggttcagatggccttaatggat
accgaagtcgaccgggtaatgggcttcggtattgccggcctctccattgtggcagactct
ttaagtgccattaaatatgctaaagtaaggccggtccggaacagtgacggccttataact
tcattcgatgttgaaggtgatcaccccagatacggtaatgatgatgaccgggttgacagc
ctggcagttgaggtcgtaaggcggtttttaacaaagcttaagcagcataaactctaccgt
aatgcccgtcacaccctgtcaattttaaccataacttcaaatgttgtctatggcacgaag
accggggccaccccggacggccgggaggcaggacagccctttgccccgggggccaatccc
atgcacggtcgtgacgaatcaggggcccttgcctcactgaatacggttgcaaaactacca
tacgagtactgccaggacggtatttccaatacctttaccatcgtccccggagccctgggt
gttaatgaagagcagcggatcaataatctggtagctattctcgatggttactttaccaaa
ggtggtcaccaccttaatgttaatgttctcaacagggaaaccctcctggatgcggtcaac
caccccgagaaatacccccagttaaccatcagggtttcggggtatgctgtaaacttcatt
aaactaacaccggagcagcagcaggaagtaatagcccggacctttcatgagagtctttaa

DBGET integrated database retrieval system