KEGG   Halothermothrix orenii: Hore_19940Help
Entry
Hore_19940        CDS       T00838                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
hor  Halothermothrix orenii
Pathway
hor00260  Glycine, serine and threonine metabolism
hor01100  Metabolic pathways
hor01110  Biosynthesis of secondary metabolites
hor01120  Microbial metabolism in diverse environments
hor01130  Biosynthesis of antibiotics
hor01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hore_19940
Enzymes [BR:hor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Hore_19940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACL70741
UniProt: B8CZM2
Position
complement(2150575..2151606)
Genome map
AA seq 343 aa AA seqDB search
MKLKVDLFSDTGTRPSKEMREFMAKAEVGDEQLGEDPSVNRLNEMVAELLGKEDAIYLPS
GLMANQISFAVHCRPGDEIIMDKTAHPIHFEGGAVSVISGASINPLDGENGIFTTEQVIK
AIRTSDYHHPRTRLISIEQTSNLGGGTIWPLDVIEDICQLAREHNLKTHMDGARLLNAVA
ATGIPASKYAEHFDSIWIDLSKGLGAPVGSVLASSRDFIEEARYWKQRLGGAMRQAGIIA
AGGIYALKHNLERLQEDNDNARYLAEEMARLKNIEIDPETVETNIVIFKVKGLTAEQFSK
ELIKRGVRVSIIAKDTLRAVTHLDVNRQDIDYALTVIKEVTGS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcttaaagtcgatttattcagtgatactggaaccagaccttctaaggaaatgaga
gaatttatggctaaagccgaggttggcgatgagcaactgggggaagatccatctgttaat
cgcctgaatgaaatggtagcagaattactgggaaaagaagacgctatctatttaccatcg
ggattaatggccaatcagatttcctttgccgtacactgccggccgggtgatgaaattatc
atggataaaacagcccaccccattcattttgaggggggagcggtcagtgttatcagtggt
gcatcaattaaccctttagatggtgagaatggtatatttaccactgaacaggttataaag
gccatcaggacatctgattaccaccaccccaggacacggcttatttccattgagcagact
tcaaatctgggaggaggtaccatctggcccctggatgtaattgaagatatttgccagctg
gcccgggagcataatctaaagacccatatggatggagctcgtcttttaaatgctgttgcc
gctaccggtattccagcttcgaagtatgctgaacactttgattctatctggattgatctc
agtaaagggttaggggctccggttggttcagtactggccagttccagggattttatagaa
gaggcaagatactggaaacagaggctgggaggggctatgcgtcaggcggggataattgct
gccggaggtatttatgccctgaagcataaccttgagcgtttacaggaagataatgataat
gccaggtatctggccgaagagatggcccggcttaaaaatatagagattgatccggagaca
gttgagaccaatatcgttatctttaaggttaagggcctgacagcagaacaattttctaaa
gaattgattaagagaggggtcagggtcagtataatcgctaaagataccctccgggcggtt
actcacctggatgttaatcgtcaggatattgattatgctttaacggtaattaaagaagtg
accggtagttaa

DBGET integrated database retrieval system