KEGG   Halothermothrix orenii: Hore_20030Help
Entry
Hore_20030        CDS       T00838                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
hor  Halothermothrix orenii
Brite
KEGG Orthology (KO) [BR:hor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Hore_20030
Enzymes [BR:hor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Hore_20030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP PHP_C
Motif
Other DBs
NCBI-ProteinID: ACL70750
UniProt: B8CZN1
Position
complement(2159164..2159841)
Genome map
AA seq 225 aa AA seqDB search
MSGFKLDMHVHTAETSRCGKVRAEQMVELYKEAGYNGVVITDHYKRGFFDNIESLGWEEQ
IKRYLTGYSTAFNRGRELGLKVFLGIELTFEESPNDFLVYGITPEFLINNPRLFTLTLKD
FKTLVNDNDILVYQAHPFRPGLNPVNPSLIDGIEVYNGNPRHDSYNDLAYQFAINNELKL
ISGSDFHQIEDVARGGIIIDGEINNERELVNFLKNTPSPELIRSV
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggattcaaactcgatatgcatgttcatacagcagagacaagcaggtgtggcaag
gtaagggcagaacagatggttgaattatataaggaagccgggtataatggtgtggtaatt
actgaccattataaacggggtttttttgataatatagaatcactgggctgggaagaacag
ataaaaaggtatcttactggttatagtacagccttcaatagaggtagggagctcggtcta
aaggtttttctgggaatagaattaacctttgaagagagtcccaatgactttctggtctat
ggtataaccccggaatttttgataaataatcccaggctctttacattaactcttaaagac
tttaaaacattggttaatgataatgatattcttgtctatcaggcccatcccttcagaccg
ggactcaatccggtcaatccttctttaattgatggaatagaagtctataatggtaacccc
aggcatgattcctataatgatctggcctaccagtttgctattaataatgagctcaagtta
atatcaggatctgactttcatcagatagaggatgttgccaggggtggtattattatagat
ggagagattaataatgagagggagctggtgaatttcttaaaaaataccccctctccagag
ttaataagatcggtttag

DBGET integrated database retrieval system