KEGG   Halothermothrix orenii: Hore_21070
Entry
Hore_21070        CDS       T00838                                 

Definition
(GenBank) cobalamin B12-binding domain protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
hor  Halothermothrix orenii
Pathway
hor00472  D-Arginine and D-ornithine metabolism
hor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Hore_21070
Enzymes [BR:hor01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Hore_21070
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ACL70852
UniProt: B8D000
Position
complement(2286884..2289076)
AA seq 730 aa
MKKLKPTEKLDIEEILKDLENYRPRRKGWTWRKKVENHKIGDFVYKDTSENLKNSVPLPA
AKNFGGIDPQPEQVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHFDGLIEGT
PEGVGGIPITRKQIRATRKALDLIEDEVGRPINFHSYVSGVAGPEIAVLFAEEGVNGAHQ
DPQYNVLYRDVNMLRSFVDAAEAKRIMAGAGLLQIDGAHNANATAREAWKVMPELFVQHA
INSLFSLKIGIPKDRIALSTVPPTASPSPDIWINLPYAVALRDLFEGFRFRAQQNTKYME
SSLREATVTHTLNLLITKLTSADIQSTITPDEGRNVPWHYNNIQAVDTAKQAFAGMDGLK
EVVEVKEEGYLKVKARELKERAVLFLEEILKVGGYFKAVESGFFVDSGRYPERNGDGIAR
EIDGGVAAGTIVPRDDDYLAPVCDHFGENNIPEELEKPCDLIGGCTLHNPDKIDFIDELD
DEDNVHKRLEKNKKYRKGNLLKPEVEWLADGWVNITIFLPINQDVAEVAALEIARKMGLK
NPEVIHKEVMHPAEGTLLEVKGQVDFDIEVDKLRIPEKQKPLPDDEIREFIDENPMRVVA
ATVGKDEHSVGLREIIDIKHGGIEKYGFKVTYLGTSVPVSKVVDAAIETNADAILISTII
THNDIHRINMRKLNDLCIEKGIRDKVILVAGGTQVSNDIAVEAGMDAGFGRGTSGDEVAS
FLVKKKRGDI
NT seq 2193 nt   +upstreamnt  +downstreamnt
gtgaaaaagctgaagcctactgaaaaacttgacatcgaggaaatattaaaagatcttgaa
aattatcggcctcgccgtaagggctggacctggcgtaagaaagtagaaaatcataagatc
ggagattttgtctataaggataccagcgaaaatttaaaaaacagtgttccccttccagca
gccaaaaactttggtgggattgacccccaacctgagcaggtaattaccaccgagatagct
tctggccggtttgaggatgatatcaggagaatgaggatggcagcctggcatggagctgac
catatcatggttatcaggactgctggacagagtcattttgatggacttattgaaggtact
cctgaaggggttgggggtatccccataaccaggaaacagatcagggctaccagaaaggct
ctggacttaattgaggatgaagtgggccgacctattaattttcattcctatgtcagcggt
gtggccggtcctgagattgcggttctctttgcagaggagggtgttaatggtgctcatcag
gatccgcaatataatgttctgtaccgtgatgtcaatatgcttcgctcttttgtcgatgca
gctgaggctaaaagaattatggccggagccggtctgctccagatagatggggcccataat
gccaatgctacggcccgggaagcctggaaggttatgcccgaattatttgtacagcatgct
ataaattcattattttctttgaaaataggtattcctaaagacaggatagccctgtcaaca
gtgccaccgactgcgtcaccatcacccgatatctggataaatcttccctatgctgtggcc
ctcagggatttatttgaaggttttcgtttcagggcccagcagaatactaaatacatggag
tcatctttaagagaggctactgtaacccatactttaaacctgttgataacaaaactgact
tcagctgatattcagagcactattactccggatgaaggaaggaatgtaccctggcattac
aacaatattcaggctgtggatacagcaaaacaggcctttgccggcatggatggtctgaaa
gaggttgtagaggttaaggaggagggttaccttaaagttaaagccagggagttgaaggag
cgagctgtattattcctggaagaaatccttaaagttggaggatactttaaagctgtagag
tcaggttttttcgttgattctggaaggtatccagaaagaaatggtgatggtattgcccgg
gaaatagatggcggggtagcagcaggaacaattgtccccagggatgatgattacctggct
ccggtatgtgaccacttcggggagaataatataccagaagaactggaaaaaccatgtgac
ctgataggtggctgtacccttcataatccagataaaattgactttatagatgaacttgat
gatgaggacaatgtccataaacggcttgaaaaaaataaaaaataccgtaaaggtaacctt
ttaaaaccggaagtggaatggttggcagatggctgggttaatattactatcttcctgccc
attaaccaggatgttgcagaagtagccgccctggaaatagccagaaaaatgggcctgaaa
aatcctgaagtgatacataaggaggttatgcacccggctgagggtaccctccttgaggta
aaagggcaggtggattttgatattgaggttgataaactgagaattcctgaaaagcaaaaa
cccctccccgatgatgaaataagggagtttattgacgaaaaccccatgagggttgtagcg
gcaacggtaggtaaagatgaacactcagtagggttaagggagattattgatattaaacat
ggtggtatcgaaaaatatgggtttaaagttacctacctggggacttcggttcctgtaagt
aaagtggtcgatgctgccattgagaccaatgctgatgctatcttgatcagtactataatt
acccacaacgatattcaccgtattaatatgagaaaactaaatgatttatgtatagagaag
ggaataagggataaagtaatattagtagccggtgggacccaggtcagtaatgatattgct
gtagaagccggaatggatgctggctttggtcgggggacttcaggtgatgaggttgccagt
tttctggttaaaaagaaaagaggagacatttaa

DBGET integrated database retrieval system