KEGG   Halothermothrix orenii: Hore_21080
Entry
Hore_21080        CDS       T00838                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
hor  Halothermothrix orenii
Pathway
hor00472  D-Arginine and D-ornithine metabolism
hor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    Hore_21080
Enzymes [BR:hor01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     Hore_21080
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A DUF2067 DUF2680
Other DBs
NCBI-ProteinID: ACL70853
UniProt: B8D001
Position
complement(2289073..2289450)
AA seq 125 aa
MGIKREDDFEQRRKHLKELSDKELNERFWQLTEKIVDPLLELARTHTSESIERSVLLRMG
FNSLEAKAIVNKVVEAGLLGKGAGHVVLKLSQKEGIPVKEAGVSISQGKRSVEELRGLFE
GGDRT
NT seq 378 nt   +upstreamnt  +downstreamnt
atggggattaaaagagaagatgattttgagcagaggagaaaacaccttaaggagctttct
gataaagaattaaatgaaaggttctggcaattaactgaaaagattgttgatcccttgctg
gaactggccaggacccatacttccgaatctattgaaagatctgtcctgttgagaatgggt
tttaatagtcttgaggccaaggccatagtcaacaaggttgtggaagcaggcctgctggga
aaaggagcgggccatgttgttttaaaactgtcacagaaagagggtattccggtaaaggaa
gccggggtttcaattagccagggtaagaggtcggtagaagaattacgaggtctttttgag
gggggtgaccggacgtga

DBGET integrated database retrieval system