KEGG   Helicobacter pylori HPAG1: HPAG1_0172Help
Entry
HPAG1_0172        CDS       T00365                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00010  Glycolysis / Gluconeogenesis
hpa00030  Pentose phosphate pathway
hpa00051  Fructose and mannose metabolism
hpa00680  Methane metabolism
hpa01100  Metabolic pathways
hpa01110  Biosynthesis of secondary metabolites
hpa01120  Microbial metabolism in diverse environments
hpa01130  Biosynthesis of antibiotics
hpa01200  Carbon metabolism
hpa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAG1_0172
   00030 Pentose phosphate pathway
    HPAG1_0172
   00051 Fructose and mannose metabolism
    HPAG1_0172
  09102 Energy metabolism
   00680 Methane metabolism
    HPAG1_0172
Enzymes [BR:hpa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     HPAG1_0172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ABF84239
UniProt: Q1CUY3
Structure
PDB: 

Position
178037..178960
Genome map
AA seq 307 aa AA seqDB search
MLVKGNEILLKAHEEGYGVGAFNFVNFEMLNAIFEAGNEENSPLFIQASEGAIKYMGIDM
AVGMVKTMCERYPHIPVALHLDHGTTFESCEKAVKAGFTSVMIDASHHVFEENLELTSKV
VKMAHNAGVSVEAELGRLMGIEDNISVDEKDAVLVNPKEAEQFVKESQVDYLAPAIGTSH
GAFKFKGEPKLDFERLQEVKRLTNIPLVLHGASAIPDNVRKSYLDAGGDLKGSKGVPFEF
LQESIKGGINKVNTDTDLRIAFIAEVRKVANEDKSQFDLRKFFSPAQLALKNVVKERMKL
LGSANKI
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctagttaaaggtaatgaaatcttattgaaagcccatgaagaaggttatggggtgggg
gcgtttaatttcgtgaattttgaaatgctaaacgctatttttgaagcaggaaacgaggaa
aattccccgcttttcattcaagcgagtgaaggagcgatcaaatacatggggattgatatg
gcggtgggcatggtgaaaaccatgtgcgaacgctacccgcacattcctgtagccttacac
ctagatcatggcacgacttttgaaagctgtgaaaaagccgtgaaagcgggtttcacttct
gtgatgattgatgcgtctcatcatgtttttgaagaaaatttggaattgacttctaaagtg
gtcaaaatggcgcataacgctggagtgagcgtggaagcggagttagggcgtttaatgggg
attgaagacaatatttcagtggatgaaaaagacgcggtgttagtgaatcctaaagaagcg
gagcagtttgtcaaagaatctcaagtggattacttagccccagccattgggacaagccat
ggagcgtttaagtttaagggcgagcccaaattggattttgaacgcttgcaagaagtcaaa
aggctcactaatatccctttagttttgcatggagcgagcgcgataccagataatgtgagg
aaatcttatttggacgctggaggcgatttgaaaggctctaagggcgtgccttttgaattt
ttacaagaatccattaagggggggatcaataaggtcaataccgacacggacttaaggatc
gctttcatcgcagaagtgcgcaaggtggctaatgaagataagagccaatttgatttgagg
aagtttttttctccggcccaattagcacttaaaaatgtggtcaaagagcgcatgaaactt
ttgggcagcgctaataaaatttaa

DBGET integrated database retrieval system