KEGG   Helicobacter pylori HPAG1: HPAG1_0402Help
Entry
HPAG1_0402        CDS       T00365                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00010  Glycolysis / Gluconeogenesis
hpa00620  Pyruvate metabolism
hpa00640  Propanoate metabolism
hpa00680  Methane metabolism
hpa01100  Metabolic pathways
hpa01110  Biosynthesis of secondary metabolites
hpa01120  Microbial metabolism in diverse environments
hpa01130  Biosynthesis of antibiotics
hpa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAG1_0402
   00620 Pyruvate metabolism
    HPAG1_0402
   00640 Propanoate metabolism
    HPAG1_0402
  Energy metabolism
   00680 Methane metabolism
    HPAG1_0402
Enzymes [BR:hpa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HPAG1_0402
Lipid biosynthesis proteins [BR:hpa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HPAG1_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABF84469
UniProt: Q1CUA3
Position
complement(410346..412334)
Genome map
AA seq 662 aa AA seqDB search
MQLDDDLEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANEDYEHFWGELAKQKLTWFKP
FDKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDKKNKVAIIFEGEMGDYNVITYRKLHS
EVNKTANLLKNEFNVKKGDRVIIYMPMIVESVYMMLACARIGAIHSIVFAGFSPEALRDR
INDAQAKLVITADGTFRKGKPYMLKPALDKALENNACPSVEKALIVIRNAKEIDYVRGRD
FVYNEMVNYQSDKCEPEMMDSEDPLFLLYTSGSTGKPKGVQHSNAGYLLWAQMTMEWVFD
IRDNDNFWCTADIGWITGHTYVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKF
YTSPTAIRMLHAKGENEPLKYNLESLKVLGTVGEPINPTAWKWFYEKIGNSKCSIVDTWW
QTETGGHIISPLPGATPIRASCATLPLPGIHAEVLNEDGTKTKPGEQGFLCITKPWPSMV
RNIWGDEKRYIDSYFSQIKLNGEYVYLSGDGAIVDENGYITIIGRTDDIVNVSGHRIGTA
EVESAISKHEMVVECAVVGIPDTIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILSVE
IGKIAKLDNVMYVPGLPKTRSGKIMRRLLKSIAKKEPITQDLSTLEDVNVVKEIMSIVQM
EE
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagacgatgatttggaattcgctaaaaaaatctttaaccctaacagagcgttt
gccaagcaagccaggattaaaaacatgtgcgaatataaagatttagtgcatgaagccaat
gaagattatgaacatttttggggcgagttagccaagcaaaaactcacatggtttaaacct
tttgataaggttttaaacagcgataacgccccttttttcaaatggtttgaaaacggcaag
atcaatgtttcttacaattgcatagacaggcatttaaaagacaaaaaaaataaagtggcg
atcatttttgaaggggaaatgggggattataatgtcatcacttacagaaaactccactct
gaagtcaataaaacagccaaccttttaaaaaacgaattcaatgtcaaaaaaggcgataga
gtcattatctatatgcctatgattgtagaaagcgtttatatgatgctcgcatgcgctagg
attggagcgatccatagcatcgtttttgctgggtttagccctgaagccttaagggatagg
atcaacgacgctcaagctaaattagttatcacagcggacgggacttttagaaaaggcaaa
ccttatatgctcaagccagcccttgacaaggctctagaaaataacgcctgccctagcgtg
gaaaaagcgctcattgtgatacgaaacgccaaagagattgactatgtgagagggcgcgat
tttgtctataatgaaatggtcaattaccaatccgataaatgcgagcctgaaatgatggac
tctgaagatcctttattcttgctctatacaagcggatcaaccggaaagcctaaaggcgtt
caacacagcaatgcagggtatttgctatgggcgcaaatgacgatggagtgggtttttgat
attagagataacgataatttttggtgcaccgctgatattggctggatcacagggcacact
tatgtggtttatgggcccttagcttgtggggcgacaactttgatactagaaggcacgatg
tcttatccggattatggaagatggtggagaatgatagaagaataccgcgtggataaattc
tacacttcccccactgctataagaatgctgcatgccaaaggcgaaaacgaacccttaaag
tataatttagagtcactcaaagttttaggaacggtaggagagcccattaaccctacggca
tggaaatggttttatgaaaaaatcggcaactcaaaatgcagtatcgtggatacttggtgg
cagacagaaacaggtgggcatatcatcagccctttaccgggagctacgcctataagggcc
agctgtgcaactttgcctttgcctggaatccatgcagaagttttaaacgaagacggcacc
aaaacaaagcccggagagcaagggtttttatgcatcactaagccatggccttctatggta
agaaacatttggggcgatgaaaaacgatacattgatagctatttttctcagatcaagttg
aatggggaatatgtctacctctctggagatggcgctatcgtggatgaaaacggatacatc
actattattgggcgcacagatgatattgtgaatgtgagtgggcataggattggcacggct
gaagtggagagcgctatttctaaacatgaaatggtggttgaatgcgcggtagtgggtatc
cctgatacgattaaaggagagggcttgtttgcgtttgtggtgctgtgtgatggggctaaa
tgcaatcttggcgagagtttagaattattaaaagaaatgaatcatatcttatccgttgaa
attggaaagatcgctaaattagacaatgtcatgtatgtgccgggtttacctaaaaccaga
agcgggaaaatcatgagaaggcttttaaaatccatcgccaaaaaagagcccatcactcaa
gatttaagcacgctagaagatgtgaatgtggttaaagaaataatgagtatcgttcaaatg
gaagagtga

DBGET integrated database retrieval system