KEGG   Helicobacter pylori HPAG1: HPAG1_0506Help
Entry
HPAG1_0506        CDS       T00365                                 

Definition
(GenBank) cag pathogenicity island protein V
  KO
K12095  cag pathogenicity island protein 10
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpa_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPAG1_0506
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpa02044]
    HPAG1_0506
Secretion system [BR:hpa02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPAG1_0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VirB8 SpmSyn_N
Motif
Other DBs
NCBI-ProteinID: ABF84573
UniProt: Q1CTZ9
Position
complement(529409..530167)
Genome map
AA seq 252 aa AA seqDB search
MLGKKNEEVLVDENLVGGVIALDRLAKLNKANRTFKRAFYLSMALNVAAVTSIVMMMPLK
KTDIFVYGIDRYTGEFKIVKRSDARQIVNSEAVVDSATSKFVSLLFGYSKNSLRDRKDQL
MQYCDVSFQTQAMRMFNENIRQFVDKVRAEAIISSNIQREKVKNSPLTRLTFFITIKITP
DTMENYEYITKKQVTIYYDFARGNSSQENLIINPFGFKVFDIQITDLQNEQTVSEILRKI
KEVESKNKALKQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttagggaaaaaaaacgaggaagtcttggttgatgaaaatttggttgggggtgtgata
gcccttgatagattggcaaaactcaataaggccaataggactttcaaaagggctttttat
ctctctatggcactcaatgtcgccgctgtaacgagtattgtgatgatgatgcctttgaag
aaaacggatatatttgtttatggcattgatcgatacacaggagaatttaaaatcgtcaaa
cgctccgatgctagacaaatcgtcaattctgaagctgttgtggatagtgcaacttcaaaa
tttgtctcattgctgtttggttatagcaaaaattctttgagggatcgcaaggatcaacta
atgcaatattgcgatgtgagttttcaaacccaagcaatgagaatgttcaatgaaaatatc
agacaattcgtagataaagtccgagcagaagctatcattagttctaacatacaaagagaa
aaagtcaaaaatagtcccttaacgagattaacatttttcattaccatcaaaatcacacct
gatacaatggaaaattatgaatatatcactaagaaacaagtaactatttattatgatttt
gctagaggtaactcttctcaagaaaatcttatcatcaatccttttggcttcaaagtgttt
gacattcaaatcacagatttacaaaacgaacagacggtaagcgaaattttgagaaagatt
aaagaagtggaatcaaaaaataaggcattaaaacaataa

DBGET integrated database retrieval system