KEGG   Helicobacter pylori HPAG1: HPAG1_0512
Entry
HPAG1_0512        CDS       T00365                                 

Definition
(GenBank) cag pathogenicity island protein M
  KO
K12101  cag pathogenicity island protein 16
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa05120  Epithelial cell signaling in Helicobacter pylori infection
Module
hpa_M00564  Helicobacter pylori pathogenicity signature, cagA pathogenicity island
Brite
KEGG Orthology (KO) [BR:hpa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    HPAG1_0512
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hpa02044]
    HPAG1_0512
Secretion system [BR:hpa02044]
 Type IV secretion system
  Cag pathogenicity island (PAI) protein
   HPAG1_0512
SSDB
Motif
Pfam: HD_assoc G0-G1_switch_2
Other DBs
NCBI-ProteinID: ABF84579
UniProt: Q1CTZ3
Position
534882..536012
AA seq 376 aa
MLAKIVFSSLVAFGVLSANVEQFGSFFNEIKKEQEEVAAKEDALKARKKLLNNTHDFLED
LIFRKQKIKELMDHRAKVLSDLENKYKKEKEALEKETRGKILTAKSKAYGDLEQALKDNP
LYKKLLPNPYAYVLNQETFTKEDKERLSYYYPQVKTSSIFKKTTATTKDKAQALLQMGVF
SLDEEQNKKASRLALSYKQAIEEYSNNISNLLSRKELDNIDYYLQLERNKFDSKAKDIAQ
KATNTLIFNSERLAFSMAIDKINEKYLRGYEAFSNLLKNVKDDVELNTLTKNFTNQKLSF
AQKQKLCLLVLDSFNFDTQSKKSILKKTNEYNIFVDSDPMMSDKTTMQKEHYKIFNFFKT
VVSAYRNNVAKNNPFE
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcttgcaaaaatcgtttttagctcattggttgcgtttggagttttgtcggctaatgtg
gagcagtttggttcatttttcaacgagataaaaaaagaacaagaagaagtggctgcaaaa
gaagacgctcttaaggctcgcaagaagctcttaaacaatacgcatgatttcttagaagac
ttgatttttagaaaacaaaaaatcaaagagcttatggatcatagagctaaagttctttca
gacttagaaaacaaatacaaaaaagaaaaagaggctctagagaaagagacaagaggtaaa
atccttactgctaagtcaaaggcttatggggatctagagcaagccttaaaagataaccct
ctctataagaaactcctccctaacccttatgcctatgttttaaaccaagaaacattcacc
aaagaagataaggagcgtttgagttattactacccccaggtgaaaacgagcagtattttt
aaaaaaaccaccgctaccactaaagataaggctcaggctttgcttcaaatgggtgtgttt
tctttagatgaagaacaaaacaaaaaagcgagccgattagctctatcttacaagcaagcg
attgaagaatattccaataacatttctaatctattgagcagaaaagaattggataatata
gattattacttacagcttgaaagaaataagtttgactccaaagcaaaagatattgctcaa
aaggctactaacacgcttatttttaactcggaacgcttggcgtttagcatggcgattgat
aagattaatgagaaatacttaaggggctatgaggctttttctaacttgttgaaaaatgtc
aaagatgatgtggaattgaatactctgactaaaaattttaccaatcaaaaattgagtttc
gcacaaaaacaaaaattgtgtttgttggttttagacagcttcaattttgatacccaatcc
aaaaaatctatattaaaaaagactaatgaatacaatattttcgtagatagcgatcctatg
atgagcgacaaaacaactatgcaaaaagaacactacaagatatttaatttcttcaaaaca
gtggtttctgcataccgaaacaatgttgccaagaataatccctttgaatag

DBGET integrated database retrieval system