KEGG   Helicobacter pylori HPAG1: HPAG1_0675Help
Entry
HPAG1_0675        CDS       T00365                                 

Definition
(GenBank) acetyl coenzyme A acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00071  Fatty acid degradation
hpa00072  Synthesis and degradation of ketone bodies
hpa00280  Valine, leucine and isoleucine degradation
hpa00310  Lysine degradation
hpa00362  Benzoate degradation
hpa00380  Tryptophan metabolism
hpa00620  Pyruvate metabolism
hpa00630  Glyoxylate and dicarboxylate metabolism
hpa00640  Propanoate metabolism
hpa00650  Butanoate metabolism
hpa00900  Terpenoid backbone biosynthesis
hpa01100  Metabolic pathways
hpa01110  Biosynthesis of secondary metabolites
hpa01120  Microbial metabolism in diverse environments
hpa01130  Biosynthesis of antibiotics
hpa01200  Carbon metabolism
hpa01212  Fatty acid metabolism
hpa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HPAG1_0675
   00630 Glyoxylate and dicarboxylate metabolism
    HPAG1_0675
   00640 Propanoate metabolism
    HPAG1_0675
   00650 Butanoate metabolism
    HPAG1_0675
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HPAG1_0675
   00072 Synthesis and degradation of ketone bodies
    HPAG1_0675
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HPAG1_0675
   00310 Lysine degradation
    HPAG1_0675
   00380 Tryptophan metabolism
    HPAG1_0675
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPAG1_0675
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HPAG1_0675
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HPAG1_0675
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpa04147]
    HPAG1_0675
Enzymes [BR:hpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HPAG1_0675
Exosome [BR:hpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HPAG1_0675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABF84742
UniProt: Q1CTI0
Position
707722..708897
Genome map
AA seq 391 aa AA seqDB search
MNEVVIVAAKRSAVGSFLGSLKNVGAREMGVCVLKDALNASSLKPSDVDSVILGNVLGAG
LGQNIARQIQLDAGIPNDKNAFSVNMVCGSSMKAIQLAHDSIMLGHGEVVVCGGVENMSM
APYLSFDMRDGKRMGNANMIDSMIHDGLWDAFNDYHMGITADNVAQAYHISREEQDNFAL
QSQLKARAAINAGKFQEEITPIEIANKKGVVVFKEDEYPRDTTLESLAKLKPAFKKDGSV
TAGNSSGINDGASIIILCSAQKAQKLGLKTMATIKGFGLGGCSPDIMGICPSIAIKNNLK
NVKMNLNDINLFELNEAFAAQSLAVLKELELNPNIVNVNGGAIAIGHPIGASGARILVTL
LHEMKRSGHGVGCASLCVGGGQGLSVVVEQK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtggttatagtggcggcaaaacggagcgctgtggggagttttctaggctct
ttaaagaatgtgggtgctagagaaatgggtgtttgcgtgcttaaagacgctttgaatgcg
agttctcttaagcctagcgatgtggattccgtcattttgggcaatgttttaggcgctggt
ttgggtcaaaatatcgctaggcagatccaactagacgccggcatcccgaatgacaaaaac
gcttttagcgtcaatatggtttgtggatcgtctatgaaagccattcaattagcacatgac
agcatcatgcttgggcatggtgaggtggtggtgtgcggtggcgtggagaacatgagcatg
gcaccttatttgtcgtttgacatgcgagatgggaaaagaatggggaatgcgaacatgata
gactccatgatccatgacggattgtgggatgctttcaatgattaccacatggggatcacc
gctgataatgtcgctcaagcataccacataagccgagaagagcaagataatttcgcgctc
caatcgcaactcaaagcaagagccgccattaatgcagggaaattccaagaagaaatcacg
cccattgaaatagcgaataaaaaaggcgtggtggtttttaaagaagacgaataccctaga
gacacgacgctagaatcccttgcaaagctcaaacccgctttcaaaaaagacggatcggta
acggcgggaaattcatcagggatcaatgatggcgcgagtattatcattttatgcagcgct
caaaaagcgcaaaaattggggttaaaaaccatggcaactatcaaggggtttggtttgggt
ggttgcagtccggatataatggggatatgccctagcatcgctattaaaaacaaccttaaa
aatgtcaaaatgaatctcaatgacatcaatctttttgaactcaatgaagcctttgccgcg
caaagcctagccgtgttaaaagagcttgagttaaaccctaatatcgtgaatgtgaatgga
ggtgcgatagcgattggccaccctattggcgcgagcggcgctaggatcttagtgacttta
ttgcatgaaatgaaaaggagcgggcatggcgtgggttgcgcgtcattgtgtgtgggcggc
gggcaaggtctttctgtggtagttgaacaaaaataa

DBGET integrated database retrieval system