KEGG   Helicobacter pylori HPAG1: HPAG1_1047Help
Entry
HPAG1_1047        CDS       T00365                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00010  Glycolysis / Gluconeogenesis
hpa00020  Citrate cycle (TCA cycle)
hpa00620  Pyruvate metabolism
hpa00640  Propanoate metabolism
hpa00650  Butanoate metabolism
hpa00680  Methane metabolism
hpa01100  Metabolic pathways
hpa01120  Microbial metabolism in diverse environments
hpa01130  Biosynthesis of antibiotics
hpa01200  Carbon metabolism
Module
hpa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAG1_1047
   00020 Citrate cycle (TCA cycle)
    HPAG1_1047
   00620 Pyruvate metabolism
    HPAG1_1047
   00640 Propanoate metabolism
    HPAG1_1047
   00650 Butanoate metabolism
    HPAG1_1047
  Energy metabolism
   00680 Methane metabolism
    HPAG1_1047
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPAG1_1047
Enzymes [BR:hpa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPAG1_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ABF85114
UniProt: Q1CSF8
Position
1103242..1103802
Genome map
AA seq 186 aa AA seqDB search
MFQIRWHARAGQGAITGAKGLADVISKTGKEVQAFASYGSAKRGAAMMAYNRVDDEPILN
HERFMQPDYVLVIDPGLVFIENIFANEKEDTTYIITSYLNKEELFEKKPELKTRKVFLVD
CLKISMETLKRPIPNTPMLGALMKVSGMLEIGAFKEAFKKVLGKKLTQEVIDANMLAIQR
AYEEVQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaattagatggcatgcgcgagctggtcaaggcgctatcaccggcgctaaagga
ctagccgatgtgatttcaaaaacaggcaaagaagtgcaagcgttcgcttcttatggttca
gctaaaaggggggctgctatgatggcttataaccgcgttgatgatgagcctattttaaac
cacgaacgcttcatgcagcctgattatgtgctggtgattgatcccggtttggttttcatt
gaaaacatcttcgctaatgaaaaagaagacacgacctatatcatcacaagctatcttaac
aaagaagaattgtttgaaaaaaaacctgaattaaaaacccgtaaggtgtttttagtggat
tgtttaaaaatctctatggaaaccttaaaacgccccatccctaacacgcccatgttaggg
gcgttaatgaaagtgtctggcatgcttgaaattggggcttttaaagaagcttttaagaaa
gttttaggcaaaaaactcacgcaagaagtcattgacgctaacatgctcgctatccaaaga
gcttatgaagaagttcaataa

DBGET integrated database retrieval system