KEGG   Helicobacter pylori HPAG1: HPAG1_1050Help
Entry
HPAG1_1050        CDS       T00365                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, beta subunit
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00010  Glycolysis / Gluconeogenesis
hpa00020  Citrate cycle (TCA cycle)
hpa00620  Pyruvate metabolism
hpa00640  Propanoate metabolism
hpa00650  Butanoate metabolism
hpa00680  Methane metabolism
hpa01100  Metabolic pathways
hpa01120  Microbial metabolism in diverse environments
hpa01130  Biosynthesis of antibiotics
hpa01200  Carbon metabolism
Module
hpa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPAG1_1050
   00020 Citrate cycle (TCA cycle)
    HPAG1_1050
   00620 Pyruvate metabolism
    HPAG1_1050
   00640 Propanoate metabolism
    HPAG1_1050
   00650 Butanoate metabolism
    HPAG1_1050
  Energy metabolism
   00680 Methane metabolism
    HPAG1_1050
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPAG1_1050
Enzymes [BR:hpa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPAG1_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Myb_DNA-bind_4
Motif
Other DBs
NCBI-ProteinID: ABF85117
UniProt: Q1CSF5
Position
1105456..1106400
Genome map
AA seq 314 aa AA seqDB search
MVKEVKTLKGFSQSAEKFQGSHLLCPGCGHGIIVREVLNAVDGPIVLGNSTGCLEVCSAV
YPHTSWDVPWIHIGFENGSTAISGVEAMYKALVNKGRYQGQKPKFVAFGGDGASYDIGLQ
FISGCMERGHDMTYICLDNENYANTGGQRSGSTPLGASTSTTPAGSVSFGKKEKKKDIVN
IMASHGVPYVAQLSPNKWKDMNKKIKTALDTEGPCFINALSPCTTEWKFESNKTIELADM
AVDSLMFPLFEIFNGRELKITYRPRNIIPVRDYLGAQKRFKHLFKKENEHIIEELQKDVN
ERWEYLQRREEAKA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaagtcaaaacactcaaaggttttagccaaagcgctgagaagtttcaaggc
tcgcacttgctttgcccgggttgtgggcatggcattattgtgcgcgaagttttaaacgct
gtagatgggcctattgttttaggcaattctaccggttgtttagaggtatgctcggctgtg
tatccgcacacttcatgggatgtgccttggattcatattggttttgaaaatggctctacg
gcgatttcaggggtggaagcgatgtataaggctttagtgaataagggccgctatcaaggt
caaaaaccaaaatttgtggcgtttggaggcgatggggccagttatgatattggtcttcaa
ttcatcagcggttgcatggaaagagggcatgacatgacttacatttgcctagataatgaa
aactacgccaataccggcggtcaaagaagcggatctacgccattaggggctagcacttct
accacgccagcaggatcggttagctttggtaaaaaagaaaagaaaaaagacatcgtcaat
atcatggcaagccatggggttccttatgtggcgcaactctcgcctaacaagtggaaagac
atgaataaaaagattaaaaccgcgctagacactgaagggccttgctttattaacgctctt
agcccatgcacgactgaatggaaatttgaatccaataaaaccattgaattagcggatatg
gctgtggatagcttgatgttccccctatttgaaatctttaatggcagggaattgaaaatc
acttaccgcccaagaaatatcattcctgtaagggattatttaggggctcaaaagcgcttc
aaacaccttttcaaaaaggaaaacgaacacattattgaagaattgcaaaaagatgtgaat
gagcgttgggaatacttgcaacgcagagaagaagctaaagcataa

DBGET integrated database retrieval system