KEGG   Helicobacter pylori HPAG1: HPAG1_1056Help
Entry
HPAG1_1056        CDS       T00365                                 

Definition
(GenBank) gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00430  Taurine and hypotaurine metabolism
hpa00460  Cyanoamino acid metabolism
hpa00480  Glutathione metabolism
hpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hpa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HPAG1_1056
   00460 Cyanoamino acid metabolism
    HPAG1_1056
   00480 Glutathione metabolism
    HPAG1_1056
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hpa01002]
    HPAG1_1056
Enzymes [BR:hpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     HPAG1_1056
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     HPAG1_1056
Peptidases and inhibitors [BR:hpa01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   HPAG1_1056
CD molecules [BR:hpa04090]
 Proteins
  HPAG1_1056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ABF85123
UniProt: Q1CSE9
Structure
PDB: 

Position
complement(1113126..1114829)
Genome map
AA seq 567 aa AA seqDB search
MRRSFLKTIGLGVIALSLGLLSPLSAASYPPIKNTKVGLALSSHPLATEIGQKVLEEGGN
AIDAAVAIGFALAVVHPAAGNIGGGGFAVIHLANGENVALDFREKAPLKATKNMFLDKQG
NVVPKLSEDGYLAAGVPGTVAGMEAMLKKYGTKKLSQLIDPAIKLAENGYAISQRQAETL
KEARERFLKYSSSKKYFFKKGHLDYQEGDLFVQKDLAKTLNQIKTLGAKGFYQGQVAELI
EKDMKKNGGIITKEDLASYNVKWRKPVVGSYRGYKIISMSPPSSGGTHLIQILNVMENAD
LSALGYGASKNIHIAAEAMRQAYADRSVYMGDSDFVSVPVDKLINKAYAKKIFDTIQPDT
VTPSSQIKPGMGQLHEGSNTTHYSVADRWGNAVSVTYTINASYGSAASIDGAGFLLNNEM
DDFSIKPGNPNLYGLVGGDANAIEANKRPLSSMSPTIVLKNNKVFLVVGSPGGSRIITTV
LQVISNVIDYNMNISEAVSAPRFHMQWLPDELRIEKFGMPADVKDNLTKMGYQIVTKPVM
GDVNAIQVLPKTKGSVFYGSTDPRKEF
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgagacggagttttttaaagacgattggcttgggtgtgatagcgctctctttgggtttg
ttaagccctttgagtgcagcgagttacccgcccattaaaaacactaaagtaggcttagcc
ctttctagccacccgctagccactgaaatcgggcaaaaggttttagaagaaggaggtaat
gcgattgatgcggccgtagcgataggttttgctctagcggttgtccatcctgcagcaggc
aatattggtggtgggggttttgcggttatccatttggctaatggtgaaaatgttgcatta
gattttagagaaaaagcccccttaaaagccactaaaaacatgtttttagacaagcaaggc
aatgtggtccctaaactcagtgaagatggctatttggcggctggggttcctggaacggtg
gcgggcatggaagcgatgttgaaaaaatacggcactaaaaaactatcgcaactcattgat
cctgccattaaattggctgaaaatggttatgcgatttcacaaagacaagcagaaacccta
aaagaagcgagggagcggtttttaaaatacagttctagcaaaaagtatttttttaaaaaa
gggcatcttgattatcaagaaggggatttgtttgtccaaaaagatttagccaagactttg
aatcaaatcaaaacgctaggcgctaaaggtttttatcaagggcaagtcgctgagcttatt
gagaaagacatgaaaaaaaatggagggattatcactaaagaggatttagccagttacaat
gtgaaatggcgcaaacccgtggtagggagttatcgtgggtataagatcatttctatgtcg
ccgccaagttcaggaggcacgcatttgatccagattttaaatgtcatggagaatgcggat
ttaagcgcccttgggtatggggcttctaagaatatccatatcgctgccgaagcgatgcgc
caagcttatgcggacaggtcggtttatatgggagattctgattttgtttcggtgccggtg
gataaattgattaataaagcgtatgccaaaaagatttttgatactatccagccagatacg
gttacgccaagctctcaaatcaagccaggaatggggcagttgcatgaggggagcaacacc
acgcattattctgtagcggacaggtgggggaatgcagtcagcgttacttacaccattaac
gcctcttatgggagcgctgctagtattgatggggcaggatttttattgaacaatgaaatg
gatgatttttccataaagcctgggaatcctaatctctatggtttagtggggggcgatgcg
aatgcgattgaagccaataagcgccctttaagctccatgtcgcctacgatcgtgttgaaa
aacaataaggttttcttggtggtgggaagccctggagggtctaggattatcactacggtg
ttgcaagtgatttctaatgtcattgattataatatgaatatttctgaagcggtctcagcc
cctagattccacatgcaatggctccctgatgaattaaggattgaaaagtttggcatgcct
gctgatgtgaaagacaacctcactaaaatgggctatcaaatcgttactaagccggtcatg
ggtgatgtgaatgcgatccaagttttacctaaaactaaagggagcgttttctatggatca
acggatccaaggaaagaattttaa

DBGET integrated database retrieval system