KEGG   Helicobacter pylori HPAG1: HPAG1_1369Help
Entry
HPAG1_1369        CDS       T00365                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00900  Terpenoid backbone biosynthesis
hpa01100  Metabolic pathways
hpa01110  Biosynthesis of secondary metabolites
hpa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HPAG1_1369
Enzymes [BR:hpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HPAG1_1369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABF85436
UniProt: Q1CRI6
Position
1421564..1422388
Genome map
AA seq 274 aa AA seqDB search
MMHVFEVYPKVNIFLKILHKEGAYHKLISRMCLVKDKLKDIISVKSALSFSLKGDFDCPL
EENSLFKALQILKNFLKSKNFSHSAIKSLDTLAIEVEKNIPTQAGLGGGSADAGGLLYHL
NHIFDWRLSLEELYSMGSLVGADTNFFISQHKSANATSYGEVIENFEEEPLENRLEIYAP
NHVFCSTKAIYQAYKPETCFSQTKEWLKKPSLECLKTCDRSELNDLLKPALLTNQALRDI
ESELGKEWFFSGSGSAFFRLKNTQKGANETHCQQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcatgtctttgaagtttatcctaaagtcaatatttttttaaaaatccttcacaaa
gaaggggcttaccacaagcttatttctcgcatgtgtttagtcaaagataagctaaaggat
attattagcgtcaaaagtgcgctttccttttcactaaaaggggattttgactgcccttta
gaagaaaactcgctctttaaagccctccaaattttaaagaattttttaaaatcaaaaaat
ttttctcattctgccatcaaatccctagacaccctagcgattgaagtggaaaaaaatatc
cccactcaagccggattaggcggtgggagcgctgatgctggggggctattgtatcatttg
aatcacatttttgactggcgtttgagtttagaagagctttatagcatgggatctttagtg
ggtgcggacaccaattttttcatctcgcaacacaaaagcgctaacgctacttcttatggc
gaagtcattgaaaattttgaagaagagcctttagaaaatcgcctagaaatctatgcacca
aatcatgttttttgcagcactaaagccatctatcaagcctataaacctgaaacttgtttt
tctcaaactaaagaatggcttaaaaagccgagtttggaatgcctaaaaacttgcgacaga
agcgaattaaacgatcttttaaagccggctttactcactaaccaagccttaagagatata
gaaagcgaattaggcaaggagtggttttttagcgggagcgggagcgcgttttttaggcta
aaaaatactcaaaagggagcgaatgaaactcattgccagcaataa

DBGET integrated database retrieval system