KEGG   Helicobacter pylori HPAG1: HPAG1_1454Help
Entry
HPAG1_1454        CDS       T00365                                 

Definition
(GenBank) cytochrome c551 peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
hpa  Helicobacter pylori HPAG1
Brite
Enzymes [BR:hpa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HPAG1_1454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Cytochrome_CBB3 Put_Phosphatase F-actin_cap_A FixO
Motif
Other DBs
NCBI-ProteinID: ABF85521
UniProt: Q1CRA1
Position
complement(1511017..1512069)
Genome map
AA seq 350 aa AA seqDB search
MKKSILLGVCLAFSCAHALNDLELIKKARESQLEPMPMGKALKEYQIKKTRDVGIGAKNS
EIMTSAQVELGKMLYFDPRISTSYLVSCNTCHNLGLGGVDLVPSAIGSQWKKNPHLLSSP
TVYNSVFNDVQFWDGRVTHLNEQAQGPIQSSFEMGADPKVVVEKINSMPGYVKLFRKAYG
SKVKIDFKLIADSIAMFEATLITPSRYDDFLRGNPKALSKAEKEGLNLFISKGCVACHNG
INLGGTMQPFGVVKPYKFANVGDFKGDKNGLVKVPTLRNITETMPYFHNGQFWDVKDAIK
EMGSIQLGIEISDEEAKKIETFFEALKGKKPKILYPELPVITDKTPKPSF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccattttattgggcgtttgtctggctttttcttgcgctcatgccctaaac
gatttagaattgatcaaaaaagcgagggaaagccaattagaacccatgcctatgggcaaa
gcgctcaaagaataccagattaaaaagaccagagatgtgggtattggcgctaaaaatagc
gaaatcatgacctccgctcaagtggaattaggcaaaatgctctattttgaccctaggatt
tccacttcctatctcgtgtcttgcaacacatgccataatctgggcttaggcggggtggat
ttagtcccaagcgctataggctctcaatggaagaaaaacccccaccttttaagttctcca
acggtgtataactctgtgtttaacgatgtgcagttttgggatggcagggttacgcattta
aacgaacaggcgcaagggccgatccaatcttcttttgaaatgggggctgatcccaaagtg
gtggtagaaaaaatcaattccatgccaggctatgtcaagctctttagaaaagcttatggc
tctaaagtcaaaattgattttaaattgatcgctgatagtatcgctatgtttgaagccacg
cttattaccccaagccgttatgatgattttttaagaggcaatcctaaagcactcagtaaa
gccgaaaaagaagggctgaatttattcatttctaaaggctgtgtggcttgccataacggc
atcaatcttgggggaacgatgcagccttttggggtggtcaaaccttataaattcgctaat
gtgggcgatttcaaaggcgataaaaacgggcttgtgaaagtgcctactttaaggaatatc
accgaaacgatgccctatttccataacgggcaattttgggatgtcaaggatgcgattaaa
gaaatgggctctatccagttaggcattgaaatcagcgatgaagaagcgaaaaaaattgaa
accttctttgaagccttaaagggtaaaaaacctaaaatactctatccagaactccctgta
ataacagacaaaacccctaaaccctctttttga

DBGET integrated database retrieval system