KEGG   Helicobacter pylori HPAG1: HPAG1_1470Help
Entry
HPAG1_1470        CDS       T00365                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hpa  Helicobacter pylori HPAG1
Pathway
hpa00220  Arginine biosynthesis
hpa00330  Arginine and proline metabolism
hpa01100  Metabolic pathways
hpa01110  Biosynthesis of secondary metabolites
hpa01130  Biosynthesis of antibiotics
hpa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    HPAG1_1470
   00330 Arginine and proline metabolism
    HPAG1_1470
Enzymes [BR:hpa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HPAG1_1470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABF85537
UniProt: Q1CR85
Structure
PDB: 

Position
complement(1531330..1532298)
Genome map
AA seq 322 aa AA seqDB search
MILVGLEAELGASKRGTDKGVRRLREALSATHGDVIKGMQTITQERCVLYKEFRYAKNFE
DYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKDKKIGILYLDAHAD
IHTAYDSDSKHIHGMPLGMVLNRVRSGFNRMSESEEKAWQKLCSLGLEKGGLEIDPKCLV
YFGVRSTEKSERDVIKELEIPLFSVGAIRENMHEVVQKTKELLKAVDIIYLSLDLDIMDG
KLFTSTGVRENNGLSFDELRQLLGLLLENFKDRLGALEVTEYNPTVSVKHNNEEEKQVLE
ILDLIIKRCKIKDKKPSFAMSS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattttagtaggattggaagcggaattaggagcgtcaaaaagaggcaccgataaaggg
gttaggcgtttgagagaggctttaagcgcaacgcatggcgatgtgattaaaggcatgcaa
acgatcactcaagagcggtgcgtgctttataaagagtttagatacgctaagaattttgaa
gattactaccttttttgtaaagaaaatctgatcccttgcatgaaagaagtgtttgagaaa
aaagaatttcctttgattttaagctcagagcatgcgaacatgtttgggattttccaagcc
tttaggagcgttcataaagacaaaaaaatagggattttgtatttagacgctcatgcggat
attcatacggcttatgacagcgattcaaagcatatccacggcatgcccttaggcatggtt
ttaaatcgtgtccgtagcgggtttaatcgcatgagcgagagcgaagaaaaggcatggcaa
aagctttgctctttggggttagaaaagggagggttagaaattgatcctaaatgtttggtg
tattttggggtaagaagcacagaaaaaagcgaaagagatgtgattaaggaattagaaatc
cccttatttagcgtgggtgcgataagagaaaacatgcatgaagtggttcaaaaaaccaaa
gagttattaaaagcggtggatattatttaccttagcttggatttagacattatggatggc
aagcttttcacttctaccggcgtgcgtgaaaataacgggctgagttttgatgaattaagg
caattactgggcttgcttttagaaaattttaaagaccgattaggagcgcttgaggtaacc
gaatacaaccccacggtgagcgtcaaacacaataacgaagaagaaaagcaggttttagaa
attttggatctcattattaagcgctgtaaaattaaagacaagaagccatctttcgcaatg
agtagctga

DBGET integrated database retrieval system