KEGG   Glaesserella parasuis KL0318: JT17_03485Help
Entry
JT17_03485        CDS       T03312                                 

Definition
(GenBank) S-adenosylmethionine tRNA ribosyltransferase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
hpak  Glaesserella parasuis KL0318
Brite
KEGG Orthology (KO) [BR:hpak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JT17_03485
Enzymes [BR:hpak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     JT17_03485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AIK89869
Position
complement(688251..689072)
Genome map
AA seq 273 aa AA seqDB search
MKYDLHSHSTASDGVLTPTELVKRAVEQNVTMLALTDHDTVAGITEAKMFAQNQPLTFIS
GVEISVLWEGKSLHLTALNIDETHPAIVNLLARQKQLRQERAELIGEKLSKAGIPNAYQG
AKALASGAVTRAHYARFLVAEGYARNDEHAFKRYLGIGKTAYVKPVWCSTEEAIAATHQA
GGVICFAHPLRYKLTAKWIRRFIEEFKQAGGDGIEVTGAAQTPDQRQLLARWAKEFDLYA
SVGSDFHYPTGWVELGKDLILPSSCKPIWALFS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatgatttacatagccatagcactgcgtccgatggcgtgcttacccccacggaa
ctcgttaaacgagcggtagaacaaaatgtaacaatgctagccttaaccgatcacgatacc
gtcgcaggtatcactgaagcgaaaatgtttgcccaaaaccaaccgcttacctttatcagt
ggtgtagaaatttctgtgttatgggaagggaaaagccttcacctcactgccttaaatatt
gacgaaacccaccctgctatcgtcaatttacttgctcgccagaaacaattacgccaagaa
cgagccgaattgattggcgaaaagctctccaaagcaggtatccctaacgcatatcaaggg
gcaaaagcccttgcaagcggtgcagttactcgcgcccattacgcccgttttcttgtggca
gaaggctatgctcgcaatgatgaacacgccttcaaacgctatctagggatcggcaaaacg
gcttatgtaaagcccgtatggtgcagcaccgaagaagccatcgcagcgacgcaccaagct
ggtggcgttatctgttttgcacacccattacgctataaattaacagcgaaatggatccgc
cgttttattgaagagtttaaacaggctggcggagatggcatagaggtaacgggagccgcc
caaacgccagaccagcgtcagcttcttgctcgttgggcaaaagagtttgatctctatgcc
tctgtcggctcagatttccactacccgacaggctgggttgagttagggaaggatttgata
ttaccttcaagctgtaagccgatttgggcattgtttagttaa

DBGET integrated database retrieval system