KEGG   Glaesserella parasuis KL0318: JT17_06430Help
Entry
JT17_06430        CDS       T03312                                 

Definition
(GenBank) long-chain fatty acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
hpak  Glaesserella parasuis KL0318
Pathway
hpak00061  Fatty acid biosynthesis
hpak00071  Fatty acid degradation
hpak01100  Metabolic pathways
hpak01212  Fatty acid metabolism
hpak02024  Quorum sensing
Module
hpak_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:hpak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JT17_06430
   00071 Fatty acid degradation
    JT17_06430
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JT17_06430
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hpak01004]
    JT17_06430
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hpak04147]
    JT17_06430
Enzymes [BR:hpak01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     JT17_06430
Lipid biosynthesis proteins [BR:hpak01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   JT17_06430
Exosome [BR:hpak04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   JT17_06430
  Exosomal proteins of breast cancer cells
   JT17_06430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AAA_30 Fe_hyd_lg_C
Motif
Other DBs
NCBI-ProteinID: AIK90371
Position
1272401..1274188
Genome map
AA seq 595 aa AA seqDB search
MASLDFHFVNRFRLQAKKWLNRTALRFREQAQWQEMSWQTFQQEIDRFSYALIAQHIDIQ
DKIGIFANNMPRWTIADFGAMQARAVAVPIYATNTAKQVEYIVNDADIKILFVGDQEQLD
QVCQIANNCPQLMKIVAMKANMDLRDLPNACYWEDFLDVVPNEAEFEKRLNSKQLSDLFT
LIYTSGTTGEPKGVMLDYANLAHQLNAHDLALNVNEDDVSLSFLPLSHIFERAWVAYVFH
RGATNCYLEDTNHVRDALTTLKPTVMCAVPRFYEKIYTAVWDKVEKAPAHRRALFNWAIR
VGEKHYQTEQPSQWLRLQYALADKLVLTKLRALLGGRIKMMPCGGAKLEASIGSFFHSIG
INIKLGYGMTETTATVSCWQDKGFNPNSIGTLMPNAEVKIGEENEILVRGGMVMRGYYKK
PEETAKAFTEDGFLRTGDVGEMDSCGNLFITDRLKELMKTLNGKYIAPQYIEGKIGKDKF
IEQIAVIADAKKYVSALIVPCFDSLEEYAKQLNIKYQDRIELIKHSDIIQMFERRIHELQ
KELPSFEQVKKFTLLPQAFSTAMEEITPTLKLRRKVIMQRYREQIEEMYNERSLT
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctcgacttccattttgtgaatagatttcgcctgcaagcaaaaaaatggctt
aatcgtaccgctttgcgtttccgtgaacaagctcaatggcaggaaatgtcgtggcaaact
tttcaacaggaaattgaccgtttctcttatgctttaattgctcaacatattgatatccaa
gataaaatcggtatttttgcaaataatatgcctcgttggactattgctgattttggggca
atgcaggcaagggcggttgctgtgccgatttatgcgacaaacacggctaaacaagtggaa
tatattgtgaatgacgctgacattaaaattctctttgtcggtgatcaagaacaacttgat
caggtctgtcaaatagcgaacaactgtccacaattaatgaaaattgtggcaatgaaggcg
aatatggatttgagggatctgccaaatgcgtgttattgggaagattttctagatgttgtt
ccaaatgaagcggaatttgagaaacgccttaattctaaacagttgtccgatctttttacg
ctgatttatacgtctggaacaacgggtgagccaaaaggtgtgatgctggattatgctaac
cttgcccatcaattaaatgctcacgatcttgccttaaatgtgaatgaagatgatgtgtcg
ctttcgttcctaccgctttcgcatatttttgagcgtgcgtgggttgcttatgtttttcat
cgtggtgcgacaaattgctacttggaagacaccaaccacgtccgtgatgccttgactaca
ctgaaaccaacggtgatgtgtgcggtgcctcgtttctatgaaaaaatttatacggcggta
tgggataaagtggaaaaagccccggcacatcgccgagccttgttcaactgggcaattcgt
gttggtgaaaagcattatcaaacagaacaaccctcacagtggcttcgtttgcaatatgct
ttggcagacaaattagtgctgactaaactgcgtgctttattaggcggtaggatcaaaatg
atgccttgcggtggagcaaagttggaagcctctattggttcatttttccacagtattggg
atcaacattaaattgggctatggaatgactgaaacgactgcaacggtttcttgctggcaa
gataagggctttaacccaaattctatcgggacattaatgccaaatgcggaagtcaaaatc
ggtgaggaaaatgaaattctggtgcgtggtggaatggtaatgcgaggctactacaagaag
cctgaagaaacggcaaaggcttttactgaagatggtttcttacgcacgggtgatgttggc
gaaatggatagttgcggaaatttattcattactgaccgcttgaaagagctgatgaaaact
ttaaatgggaaatatatcgctccgcaatacattgagggcaaaatcggtaaagataagttt
attgagcagattgctgtgattgcagatgcgaagaagtatgtttctgccttgattgtgccg
tgttttgatagccttgaggaatatgcaaagcaacttaatatcaaatatcaggataggatc
gagctgattaaacattctgacattattcagatgtttgaaagacgtatccacgagttgcaa
aaagaactcccgagctttgagcaggtgaagaaatttactctcttgcctcaggcttttagt
acggcaatggaagaaatcaccccgacgctgaaattacgtcgtaaagtgattatgcaacgc
tatcgggagcagattgaggagatgtataatgaacgttcattaacttaa

DBGET integrated database retrieval system