KEGG   Glaesserella parasuis KL0318: JT17_09350Help
Entry
JT17_09350        CDS       T03312                                 

Definition
(GenBank) 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
hpak  Glaesserella parasuis KL0318
Pathway
hpak00130  Ubiquinone and other terpenoid-quinone biosynthesis
hpak01100  Metabolic pathways
hpak01110  Biosynthesis of secondary metabolites
Module
hpak_M00116  Menaquinone biosynthesis, chorismate => menaquinol
Brite
KEGG Orthology (KO) [BR:hpak00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    JT17_09350
Enzymes [BR:hpak01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     JT17_09350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Palm_thioest Abhydrolase_3 Lipase_3 DUF676 PGAP1 Abhydrolase_5 Abhydrolase_2 DUF726
Motif
Other DBs
NCBI-ProteinID: AIK90867
Position
1860432..1861199
Genome map
AA seq 255 aa AA seqDB search
MLATTWHSHSGTPVVFLHGFLGSQQDWQPVLSLLQNEIAIRPLTLDLAGHGHSQAISCHS
FQQAREQLHHILQQHLAEQPFYLVGYSLGGRLALDYALTTQNPYLKGILLEGANIGLSSD
EEKKARWQNDCHWADRLSNEPLANVLEDWYRQPVFANLSESKRTDFIKKRLNNHGQALAQ
MLKATSLAKQSYFSPEQCHQFHGKMLFIMGERDSKFHQMAEQHQLPYHQIANAGHNTHYE
NPGAFVKHLIQFISK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttagcaacaacttggcacagtcattcaggaacacccgtggtctttctccacgggttt
cttggttctcaacaagattggcaacccgtcctctcgctattgcaaaatgagattgcaatc
cgaccgcttacccttgatcttgctggtcatggtcacagccaagctatctcgtgccatagt
tttcagcaagccagagaacagcttcaccacatcttgcaacaacatcttgctgaacagccc
ttctatcttgtcggctattcattaggcggtagattagctttagattacgccctcacaacc
caaaatccttatcttaaagggatcctactcgaaggggcaaatatcggcttaagcagtgat
gaagaaaaaaaagcacgttggcaaaatgattgccactgggcagatcgcctaagcaatgaa
ccgcttgcaaatgttttagaagattggtatcgacagcctgtctttgccaatttaagcgaa
agcaagcggacagatttcatcaaaaaaaggctaaataatcacgggcaagcactagctcaa
atgctcaaagccactagccttgcaaaacaatcctatttttccccagagcaatgtcatcag
tttcacgggaaaatgctatttattatgggagagcgggatagtaagtttcatcaaatggca
gaacaacatcagctcccctatcatcaaattgcaaatgcaggacataacacccattatgaa
aatccaggtgcatttgtaaaacaccttattcagtttatatcaaagtag

DBGET integrated database retrieval system