KEGG   Hafnia paralvei: AL518_08150
Entry
AL518_08150       CDS       T05667                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
hpar  Hafnia paralvei
Pathway
hpar00230  Purine metabolism
hpar01100  Metabolic pathways
hpar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AL518_08150
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AMH17987
Position
complement(1831487..1831963)
AA seq 158 aa
MKHKNWVDIECQINGKTYQFCLSPAMSLMELLREQGLTSVKQGCGVGECGACTVLIDGVA
TDSCLYLAVWADGKQIRTAEGEVRNGEISKVQQAYVNAGAVQCGFCTPGLVMATTALLAK
HTSRPLTHEEIRRGLAGNLCRCTGYQMVIRAVDACRDE
NT seq 477 nt   +upstreamnt  +downstreamnt
atgaaacataaaaactgggttgatattgaatgccaaattaatggcaaaacctatcaattt
tgcctgtctccagcgatgtctttaatggaattgctacgtgaacaaggcctaaccagcgtg
aagcagggatgcggagtcggagaatgcggtgcttgcaccgtgctgattgacggcgttgcc
actgacagttgcttatacctcgccgtatgggccgatggtaagcagatccgcaccgccgaa
ggcgaggtgagaaatggggaaatatcaaaggtacaacaggcatacgtcaatgctggcgcg
gtacagtgcggattctgcacgccgggtttggtgatggcaacgacggcattgctggctaaa
catacctctcgcccgctgacgcacgaagaaatccgccggggattagcgggtaatctatgc
cgttgcacagggtatcaaatggtgatccgcgcagtagatgcatgtagggatgaatag

DBGET integrated database retrieval system