KEGG   Hafnia paralvei: AL518_08275Help
Entry
AL518_08275       CDS       T05667                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
hpar  Hafnia paralvei
Brite
KEGG Orthology (KO) [BR:hpar00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AL518_08275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AMH18008
UniProt: A0A2A2MDE8
Position
complement(1859444..1859821)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVQVQSAYAETQSLPDEERFVFAYTITIRNLGRFNVQLLRRYWLITNGNGRQT
EVQGEGVIGEQPLILPNNEFQYTSGAIIETPCGTMEGHYEMIDHQGQEFRIAIPVFRLAI
PTLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcacctcgtgtgtgtgttcaggtacaaagtgcctatgccgaaacccaatca
cttccagatgaagagcgttttgtttttgcatataccatcaccatcaggaatctaggacga
ttcaatgtgcagctcctgcggcgttactggctgattaccaatggtaacggacgtcagacg
gaagttcagggcgaaggcgtcatcggtgaacagccactgattttgcccaacaatgagttc
caatacaccagcggtgccattattgaaacgccttgcggcacaatggaaggtcattatgaa
atgattgaccatcagggtcaggagttccgtattgcgattcccgtatttcgtttagcaatc
ccaactctaattaactag

DBGET integrated database retrieval system