KEGG   Glaesserella parasuis SH03: JL26_03710Help
Entry
JL26_03710        CDS       T03301                                 

Definition
(GenBank) methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
hpas  Glaesserella parasuis SH03
Brite
KEGG Orthology (KO) [BR:hpas00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hpas03009]
    JL26_03710
Enzymes [BR:hpas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     JL26_03710
Ribosome biogenesis [BR:hpas03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    JL26_03710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX Spt5-NGN
Motif
Other DBs
NCBI-ProteinID: AIK16978
Position
681021..681278
Genome map
AA seq 85 aa AA seqDB search
MNKLALYCRAGFEKEVAGEINDKAAQLGIYGFANLKENSGYVIFECYQAGEADRLARELA
FNQLIFVRQMIVVGELLQEIRLLRY
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattagctttatactgccgtgcaggttttgaaaaggaagtggcaggtgaaatc
aatgataaagcggctcaattgggaatttatgggtttgctaatctcaaagagaacagtggt
tatgtgatttttgagtgctatcaggcaggggaagcggatagattagccagagaattagcc
tttaatcagttgatttttgttcgtcaaatgattgtggtaggcgagttgttgcaggagata
cgattgcttcgttattag

DBGET integrated database retrieval system