KEGG   Glaesserella parasuis ZJ0906: K756_06410Help
Entry
K756_06410        CDS       T02697                                 

Gene name
metX
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00270  Cysteine and methionine metabolism
hpaz00920  Sulfur metabolism
hpaz01100  Metabolic pathways
hpaz01110  Biosynthesis of secondary metabolites
hpaz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    K756_06410 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    K756_06410 (metX)
Enzymes [BR:hpaz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     K756_06410 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     K756_06410 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Peptidase_S28 Hydrolase_4 DUF2920 Esterase
Motif
Other DBs
NCBI-GeneID: 16165451
NCBI-ProteinID: AGO16458
Position
1207430..1208503
Genome map
AA seq 357 aa AA seqDB search
MAQQITLFDDIPLELALGGTLSPINVAYQTYGTLNAEKSNAVLLCHALTGDAEPYYAPPA
DKGWWQDFIGAGLAFDTDKYFFICSNVLGGCKGTTGPSSINPNTNKPYGSQFPVITVQDI
VKVQKALIDKLGITQLQAVVGGSFGGMQATQWAIDYPEQVRNVVNLCSSLTLSAEAIGFN
HVMRQAVINDPHFNNGDYYGSTPPDNGLKIARMLGMLTYRTDVQLAKAFGREVKQTGTIW
GDHFQVESYLSYQGVKFLDRFDANSYLRLLRALDLYDPALTYANEQEALSRIKANYTLVG
VTSDQLFKQIDLHKSKQRLENAGITVDFYEFHSDFGHDAFLVDYPFFEEMIKKGISK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcagattactctttttgatgatattccccttgagcttgctttaggcggaaca
ctttcgcctatcaatgtcgcttaccaaacctatggcacattgaacgctgaaaaaagcaat
gctgtgctgttgtgccacgccttgacgggtgacgctgaaccctattatgcaccgcctgcg
gataaaggctggtggcaagattttatcggtgcaggattagcttttgacaccgataaatac
ttttttatctgctcgaatgtgcttggcggttgcaaaggtacgacaggcccttcgtctatc
aatccaaatacgaataaaccctacggcagtcaatttcccgttattaccgtgcaagatatt
gtgaaagtgcaaaaagccttgatcgataaactcggtattactcagctacaagcggtcgtg
ggtggctcttttggcggaatgcaagcgacacagtgggcgattgattatccagaacaagtg
agaaatgtggttaatctctgttcttcgcttaccttgagtgcagaagcaatcggcttcaat
cacgttatgcgacaagcggtgataaacgatccccattttaacaacggcgattattatggc
agtacgcccccagataacggcttaaaaattgcccgaatgctcggtatgctcacctaccgc
accgatgtacaacttgccaaagcctttgggcgtgaagtgaaacagacgggaacgatttgg
ggcgatcacttccaagtggaatcgtatctcagctatcaaggggtcaaatttctagatcgc
tttgacgccaatagttacttacgcctgttaagagccttagatctctatgatcctgcttta
acctatgcaaacgagcaagaagcactcagtcgcattaaagcgaattacacccttgtcggc
gtaacgagcgatcaactgtttaaacagattgacctacacaaaagcaaacagcgtttagaa
aatgcaggcattaccgtcgatttttacgaatttcattccgactttggacacgatgcgttt
ttagttgactacccgttttttgaagagatgattaagaaaggaatctccaagtag

DBGET integrated database retrieval system