KEGG   Glaesserella parasuis ZJ0906: K756_10920Help
Entry
K756_10920        CDS       T02697                                 

Definition
(GenBank) DNA mismatch repair protein MutS
  KO
K03555  DNA mismatch repair protein MutS
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    K756_10920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hpaz03400]
    K756_10920
DNA repair and recombination proteins [BR:hpaz03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Mismatch and loop recognition factors
     K756_10920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MutS_V MutS_I MutS_III MutS_IV MutS_II
Motif
Other DBs
NCBI-GeneID: 16166825
NCBI-ProteinID: AGO17281
Position
complement(2100694..2103291)
Genome map
AA seq 865 aa AA seqDB search
MKNQNNFLQHTPMMAQYLQLKAQNPDILLFYRMGDFYELFYDDAKKAAALLDISLTKRGQ
SAGEPIPMAGVPYHAVEGYLAKLVALGESVAICEQIGDPATSKGPVERKVVRIITPGTVS
DEALLPERQDNLVAAIYQEKGVFALATLDMASGRFLISELPNKEALSAELQRTQPAEILY
PEDFSDVGILQGYKGLRRRPVWEFELVTAIQLLNRQFGTQNLTGFGVEKAVVALCAAGCV
LHYAQETQRTALPHINSIHLAQNSDTVLLDSATRRNLELTTNLAGGTENTLTSVLDKCVT
SMGSRLLKRWIHQPIRDLAKLHTRQQTILALQKNERIEPLQPLLQQVGDMERILARVALR
TARPRDLTRLRTALEHIPDIVKHSQHQTACLDNTLQQIADFSELFELLNQAIIDNPPQLI
RDGGVIAEGYNAELDEWRSLAEGATKFLEDLEARERAKTGIDTLKIGFNAVHGYYIQISQ
GQAHKAPIHYVRRQTLKNAERYIIPELKTYEDKVLKAKGASLALEKQLYDELFELLMPRL
GELQLASFVLAELDVLTNLAERAESLNYVMPSFSHQRGVNIKGGRHPVVEQVLKTPFIAN
PVLLNPQRHLLIVTGPNMGGKSTYMRQIALITLMAYIGSFVPADSAEIGPIDRIFTRIGA
SDDLASGRSTFMVEMTEMANILHQSSENSLVLVDEIGRGTSTYDGLSLAWACAEWLAKKT
QSLTLFATHYFELTSLPNQLKGVANIHLDALEHNDTIAFMHSVQEGAASKSYGLAVAALA
GVPKQVIQLAKQKLTQLERLSQQTAQLDANQQQDLLFSANLQNAEPISPLIEPSKVEQAL
AEIDPDELTPKQALEMLYRLKLLIK
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaaaataatttcctacagcacacgccaatgatggctcaatatctccaactc
aaagcacaaaatcccgatattcttctgttctatcgtatgggcgatttttatgagttattt
tacgacgatgccaaaaaagcggctgcgttgttagatatttctctgactaaacgtgggcaa
tcagcaggtgaaccaattccaatggctggggtaccgtatcacgctgttgaaggttatttg
gcgaagttggtggcgttgggtgagagtgtggcgatttgtgagcaaatcggcgatcctgca
accagtaaaggccctgttgagcgtaaagtcgtacgaattatcacacctggaacggtcagc
gacgaagcgttgctaccagaacgccaagacaatttggtcgccgcaatttatcaagaaaaa
ggcgttttcgcccttgcgacattagatatggcttctgggcgttttttgattagcgaatta
cctaacaaagaggcactgtctgctgagttacaacgcacccaacctgccgagattttgtat
cctgaagatttttctgatgtaggtattttacagggttacaaaggcttacgccgccgacct
gtttgggaatttgagctagttacagccattcagttgcttaatcgccaatttgggacacaa
aatcttacaggttttggagtagaaaaggcggtggttgccttgtgtgcggctggttgtgtc
ttgcattatgctcaagaaactcaacgcaccgcactgccacatatcaacagcattcatttg
gctcaaaatagcgatactgtcttacttgattcggcaactcgcagaaatttggaattaacc
accaatctggcaggcggtacagaaaacacacttacatcggttttggataaatgcgtcacc
tcaatggggagtcgtttactcaaacgttggatccatcaacctattcgtgatttagccaaa
ctgcatactcgccagcaaactattttggcattgcaaaaaaatgaacgtatcgaaccgctt
cagcccctgctacaacaagtaggcgatatggaacggattttggctcgcgttgcattacgc
actgctcgccctcgtgacctaacccgtttacgcacagctttagagcatattcccgatatt
gtaaaacattcacaacatcagaccgcttgtttagacaatactttgcagcagatcgccgat
tttagcgagctattcgagctattaaaccaagcaatcattgataacccaccgcaacttatc
cgtgacggtggcgttatcgccgaaggctacaatgctgagttggacgaatggcgaagtttg
gcagaaggggcaaccaaattccttgaagatttagaagcgagagaacgagccaaaacaggc
attgatacccttaaaatcggattcaatgcggtacacggctactatatccaaatcagtcaa
ggacaggctcacaaagctccgatccactatgtccgccgtcaaaccttaaagaatgcggaa
cgttacattatccctgagctgaaaacctatgaagataaggtgttgaaagccaaaggggct
tctcttgcccttgaaaaacagctttatgatgaactgtttgaactgttaatgccacgtttg
ggtgaattgcagttggcaagctttgtgttagcagaacttgatgtgctgaccaaccttgcc
gaacgtgccgaaagtttgaattatgtaatgccaagtttcagccatcagcgaggcgtgaat
atcaaaggcggtcgccaccctgttgttgaacaagtactgaaaacaccgtttatcgccaac
cctgtactgctcaatccacaacgccatttgctgatcgtcacaggtccgaatatgggcggt
aaaagtacctatatgcgacaaattgccttgattactttaatggcatatatcggcagtttt
gtgcctgcggacagtgcagaaatcggaccgattgaccgtatttttacccgtatcggtgct
tctgatgatttagcttcagggcgttcaacctttatggtggaaatgaccgaaatggcgaac
attctgcaccaatccagcgaaaacagccttgttcttgttgatgaaatcgggcgaggcacc
tcgacctacgatggcttatcactcgcttgggcgtgtgccgaatggttagcgaagaaaacc
caatcgctcaccctatttgccacccactactttgagctaaccagcttaccaaaccagctc
aaaggcgttgccaatatccatttagatgcgttggaacataacgacactatcgcctttatg
cacagcgtacaagaaggggcagcaagtaaaagttatggtttagccgttgccgccctagca
ggcgtaccaaagcaggtgatccaacttgcgaaacagaaactcacacagcttgaacgactt
tcgcaacaaacggcacaattagacgcaaatcaacagcaagatttactcttttcggcgaat
ttgcaaaatgctgaaccaatctcaccgcttatcgaaccgtccaaagtcgaacaagccctc
gcagagattgatcccgatgaactcacaccgaaacaggcgttggagatgttgtatcggttg
aagttacttataaaataa

DBGET integrated database retrieval system