KEGG   Glaesserella parasuis ZJ0906: K756_10930Help
Entry
K756_10930        CDS       T02697                                 

Definition
(GenBank) diaminopimelate decarboxylase
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz00300  Lysine biosynthesis
hpaz01100  Metabolic pathways
hpaz01110  Biosynthesis of secondary metabolites
hpaz01120  Microbial metabolism in diverse environments
hpaz01130  Biosynthesis of antibiotics
hpaz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    K756_10930
Enzymes [BR:hpaz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     K756_10930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Orn_DAP_Arg_deC Ala_racemase_N
Motif
Other DBs
NCBI-GeneID: 16167085
NCBI-ProteinID: AGO17283
Position
complement(2104570..2105829)
Genome map
AA seq 419 aa AA seqDB search
MDYFHYKNQQLFAEDVAITDIIAQHGTPAYIYSRATLERHWHAFDKAFGDHPHLICFAVK
SNSNLALLNVIARLGSGFDIVSQGELERVLAAGGDASKVVFSGVAKSHREIARALEVGIR
CFNVESVSELKRINEVAGQLGKIAPISLRVNPDVDAKTHPYISTGLKENKFGVSVKEARE
VYRFATTLPHVKITGMDCHIGSQLTELQPFLDATDRVIVLMEQLKQDGIELHHLDLGGGL
GVTYTDETPPHPMEYAAALLHKLRTYPNLEIILEPGRAITANAGILVTKVEYIKQNEDRR
FAIVDTGMNDMIRPALYEAYMQIIEVNQSLVREKAIYDVVGPICETSDFLGKQRELAIAE
GDLIAMRSAGAYGATMSSTYNSRPQAVEVMVDGDKAHLIKARASFEDLWRLENIVPLCN
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggattattttcattataaaaaccaacaacttttcgcagaagatgtcgccattacagac
attattgcgcagcatggcacaccagcttatatttactctcgggcaacacttgaacgccat
tggcatgcttttgataaggcatttggtgatcacccacacttaatttgcttcgcagtcaaa
tctaactctaaccttgccctgctaaatgtaatagctcgtttaggctcaggctttgacatt
gtttctcaaggggaattagagcgagtattagctgcagggggggatgcaagtaaagtggtt
ttctctggggtggcaaaatcgcatagagaaattgctcgtgctttagaagttggcattcgt
tgttttaatgttgagtcggtttctgaattaaaacgcattaacgaagttgcaggacaactt
ggtaagattgccccaatttcattacgtgtaaatccagatgtcgatgctaaaactcaccct
tatatttcgacagggttaaaagaaaataaatttggtgtaagtgtcaaagaggctcgtgaa
gtttatcgttttgctactaccttacctcatgtaaaaattacaggaatggattgccatatt
ggttcacaacttaccgaattacagccatttttagatgccactgaccgtgtgattgtgctt
atggaacagctaaaacaggatggtatcgaactgcatcaccttgatcttggcggcggctta
ggggtgacttatacggatgaaacaccgccacacccaatggaatatgctgcagcgttgctc
cataaacttcgaacctacccaaaccttgagatcattttagagccagggagagcgattact
gcaaatgcaggcattttagtcactaaagttgaatatattaaacaaaatgaagatcgacgc
tttgccattgtagatacagggatgaacgatatgatccgccctgcattatatgaagcgtat
atgcaaattattgaagtaaaccaatcgcttgtacgtgaaaaggcaatttacgatgtcgtt
ggtccaatttgtgaaacgtcagactttttaggtaaacagcgagaacttgcaattgccgaa
ggggatctaattgcaatgcgttctgccggagcttatggtgcaacaatgtcctcaacttac
aattcacgtccacaagctgtagaagtgatggttgatggtgataaagctcacttaattaaa
gctcgagcaagttttgaagatttatggcgtttagagaatatagtgcctctttgtaattaa

DBGET integrated database retrieval system