KEGG   Glaesserella parasuis ZJ0906: K756_10970Help
Entry
K756_10970        CDS       T02697                                 

Gene name
rplC
Definition
(GenBank) 50S ribosomal protein L3
  KO
K02906  large subunit ribosomal protein L3
Organism
hpaz  Glaesserella parasuis ZJ0906
Pathway
hpaz03010  Ribosome
Module
hpaz_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:hpaz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    K756_10970 (rplC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hpaz03011]
    K756_10970 (rplC)
Ribosome [BR:hpaz03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    K756_10970 (rplC)
  Bacteria
    K756_10970 (rplC)
  Archaea
    K756_10970 (rplC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L3
Motif
Other DBs
NCBI-GeneID: 16165613
NCBI-ProteinID: AGO17289
Position
2112248..2112874
Genome map
AA seq 208 aa AA seqDB search
MIGLVGRKVGMTRIFNEDGVSVPVTVIEIEANRVTQVKTLENDGYTAVQVTTGSKKASRV
TKPEAGHFVKAGVEAGRGLWEFRTEGEEFTLGQEINVDIFTDVKKVDVTGTSKGKGFQGG
VKRWNFRTQDATHGNSLSHRVLGSIGQNQTPGRVFKGKKMAGHLGAERVTVQSLEVVRVD
AERKLLLVKGSVPGATNSDVIVKPAVKA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattggtttagtcggtcgtaaagttggtatgacccgtatcttcaatgaagacggcgtg
tcagttccagttaccgttatcgaaatcgaagccaaccgtgtgactcaagttaaaactctt
gaaaacgatggctatactgcagttcaagttactactggctctaaaaaagcaagtcgtgta
actaagcctgaagcaggtcatttcgttaaagcaggtgttgaagctggtcgcggtttatgg
gaatttcgtactgaaggtgaagaattcactttaggtcaagaaatcaacgtagacatcttc
acagatgttaaaaaagtagatgttactggtacatcaaaaggtaaaggtttccaaggtggt
gttaaacgttggaacttccgtactcaagatgctactcacggtaactctttatcacaccgt
gtacttggttctattggtcaaaaccaaactccaggtcgtgtgtttaaaggtaaaaaaatg
gctggacacttaggtgctgagcgtgtaaccgttcaatcacttgaagttgttcgtgtagat
gctgagcgtaaattattattagttaaaggttctgtacctggtgcaactaatagtgatgtt
attgttaaaccagcagttaaagcataa

DBGET integrated database retrieval system